Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.03
PubTator Score 2.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
aldosterone-producing adenoma -1.059 1.1e-02
Atopic dermatitis -1.100 2.6e-04
atypical teratoid/rhabdoid tumor 1.400 4.5e-04
ductal carcinoma in situ 1.100 4.0e-03
ependymoma 1.200 3.0e-02
lung carcinoma 1.200 3.6e-17
osteosarcoma 1.057 4.6e-02
ovarian cancer 1.100 1.1e-03
sonic hedgehog group medulloblastoma 1.500 4.7e-04

Synonym

Accession Q96NH3 Q5SZD6 Q5SZM6 Q6ZMY4 Q6ZUR7 Q8NB47
Symbols BROMI
C6orf170
C6orf171
bA57L9.1
bA301B7.2
dJ310J6.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MAHFSSEDQAMLQAMLRRLFQSVKEKITGAPSLECAEEILLHLEETDENFHNYEFVKYLRQHIGNTLGSM      1 - 70
IEEEMEKCTSDRNQGEECGYDTVVQQVTKRTQESKEYKEMMHYLKNIMIAVVESMINKFEEDETRNQERQ     71 - 140
KKIQKEKSHSYRTDNCSDSDSSLNQSYKFCQGKLQLILDQLDPGQPKEVRYEALQTLCSAPPSDVLNCEN    141 - 210
WTTLCEKLTVSLSDPDPVFSDRILKFCAQTFLLSPLHMTKEIYTSLAKYLESYFLSRENHIPTLSAGVDI    211 - 280
TNPNMTRLLKKVRLLNEYQKEAPSFWIRHPEKYMEEIVESTLSLLTVKHNQSHVVSQKILDPIYFFALVD    281 - 350
TKAVWFKKWMHAHYSRTTVLRLLETKYKSLVTTAIQQCVQYFEMCKTRKADETLGHSKHCRNKQKTFYYL    351 - 420
GQELQYIYFIHSLCLLGRLLIYKQGRKLFPIKLKNKKGLVSLIDLLVLFTQLIYYSPSCPKMTSAAHSEN    421 - 490
YSPASMVTEVLWILSDQKECAVECLYNNIVIETLLQPIHNLMKGNEASPNCSETALIHIAGILARIASVE    491 - 560
EGLILLLYGANMNSSEESPTGAHIIAQFSKKLLDEDISIFSGSEMLPVVKGAFISVCRHIYSTCEGLQVL    561 - 630
ITYNLHESIAKAWKKTSLLSERIPTPVEGSDSVSSVSQESQNIMAWEDNLLDDLLHFAATPKGLLLLQRT    631 - 700
GAINECVTFIFNRYAKKLQVSRHKKFGYGVLVTRVASTAAGGIALKKSGFINELITELWSNLEYGRDDVR    701 - 770
VTHPRTTPVDPIDRSCQKSFLALVNLLSYPAIYELVRNQDLPNKTEYSLREVPTCVIDIIDRLIILNSEA    771 - 840
KIRSLFNYEQSHIFGLRDFIIDGLSVERNHVLVRINLVGGPLERILPPRLLEKSDNPYPWPMFSSYPLPN    841 - 910
CYLSDITRNAGIKQDNDLDKLLLCLKISDKQTEWIENCQRQFCKMMKAKPDIISGEALIELLEKFVLHLT    911 - 980
ESPSECYFPSVEYTATDANVKNESLSSVQQLGIKMTVRYGKFLSLLKDGAENDLTWVLKHCERFLKQQQT    981 - 1050
SIKSSLLCLQGNYAGHDWFVSSLFMIMLGDKEKTFQFLHQFSRLLTSAFLWLPRLHISSYLPNDTVESGI   1051 - 1120
HPVYFCSTHYIEMLLKAELPLVFSAFHMSGFAPSQICLQWITQCFWNYLDWIEICHYIATCVFLGPDYQV   1121 - 1190
YICIAVFKHLQQDILQHTQTQDLQVFLKEEALHGFRVSDYFEYMEILEQNYRTVLLRDMRNIRLQST      1191 - 1257
//

Text Mined References (9)

PMID Year Title