Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.41
PubTator Score 5.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cervical cancer 21 3.594 1.8

Expression

Gene RIF (3)

PMID Text
25134998 This is the first study to show that ZNF582 methylation analysis of cervical swabs may be a promising choice in the positive triage of cytological diagnoses of low-grade squamous intraepithelial lesions
24407576 Methylation levels of ZNF582 in uterine cervix adenocarcinomas is significantly higher than those in normal cervical tissues.
22815913 ZNF582 is frequently methylated in cervical intraepithelial neoplasia 3 and worse lesions

AA Sequence

MSLGSELFRDVAIVFSQEEWQWLAPAQRDLYRDVMLETYSNLVSLGLAVSKPDVISFLEQGKEPWMVERV      1 - 70
VSGGLCPVLESRYDTKELFPKQHVYEVESPQWEIMESLTSYGLECSSFQDDWECRNQFDRQQGNPDRHFH     71 - 140
QMIIRHEEMPTFDQHASLTFYQKIHTREKPFGYNKCRKDFWQKELLINHQGIYTNEKPYKCKECGKAFKY    141 - 210
GSRLIQHENIHSGKKPYECKECGKAFNSGSNFIQHQRVHTGEKPYECKDCEKAFSRSSQLIEHQRTHTGE    211 - 280
KPYQCKECGKAFNRISHLKVHYRIHTGEKPYACKECGKTFSHRSQLIQHQTVHTGRKLYECKECGKAFNQ    281 - 350
GSTLIRHQRIHTGEKPYECKVCGKAFRVSSQLKQHQRIHTGEKPYQCKVCGRAFKRVSHLTVHYRIHTGE    351 - 420
KPYECKECGKAFSHCSQLIHHQVIHTEKKPYEYKECEKTLSHDSTTVQPQRMHNRETHVNIINVEKPSIS    421 - 490
SYPLLIIREFMLASNHMNGSNGESPLA                                               491 - 517
//

Text Mined References (10)

PMID Year Title
25985991 2015 Concordance analysis of methylation biomarkers detection in self-collected and physician-collected samples in cervical neoplasm.
25945131 2015 Comparison of HPV genotyping and methylated ZNF582 as triage for women with equivocal liquid-based cytology results.
25134998 2014 Methylated ZNF582 gene as a marker for triage of women with Pap smear reporting low-grade squamous intraepithelial lesions - a Taiwanese Gynecologic Oncology Group (TGOG) study.
24407576 2014 High methylation rate of LMX1A, NKX6-1, PAX1, PTPRR, SOX1, and ZNF582 genes in cervical adenocarcinoma.
24123876 2013 Identification of pathogenic gene variants in small families with intellectually disabled siblings by exome sequencing.
22815913 2012 Methylomic analysis identifies frequent DNA methylation of zinc finger protein 582 (ZNF582) in cervical neoplasms.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.