Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.45
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.7e-05
cystic fibrosis -2.800 1.8e-06
glioblastoma multiforme 1.300 9.6e-21
group 3 medulloblastoma 1.600 3.3e-05
ovarian cancer -1.100 1.1e-04

AA Sequence

MAAVILPSTAAPSSLFPASQQKGHTQGGELVNELLTSWLRGLVTFEDVAVEFTQEEWALLDPAQRTLYRD      1 - 70
VMLENCRNLASLGCRVNKPSLISQLEQDKKVVTEERGILPSTCPDLETLLKAKWLTPKKNVFRKEQSKGV     71 - 140
KTERSHRGVKLNECNQCFKVFSTKSNLTQHKRIHTGEKPYDCSQCGKSFSSRSYLTIHKRIHNGEKPYEC    141 - 210
NHCGKAFSDPSSLRLHLRIHTGEKPYECNQCFHVFRTSCNLKSHKRIHTGENHHECNQCGKAFSTRSSLT    211 - 280
GHNSIHTGEKPYECHDCGKTFRKSSYLTQHVRTHTGEKPYECNECGKSFSSSFSLTVHKRIHTGEKPYEC    281 - 350
SDCGKAFNNLSAVKKHLRTHTGEKPYECNHCGKSFTSNSYLSVHKRIHNRWI                      351 - 402
//

Text Mined References (5)

PMID Year Title