Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
CILIARY DYSKINESIA, PRIMARY, 35 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 1.8e-09
ependymoma 4679 1.2e-08
nasopharyngeal carcinoma 1058 2.7e-06
group 3 medulloblastoma 4104 2.1e-03
chronic rhinosinusitis 512 2.5e-02
Disease Target Count
Primary ciliary dyskinesia 76

Expression

  Differential Expression (5)

Disease log2 FC p
chronic rhinosinusitis -1.867 2.5e-02
ependymoma 2.300 1.2e-08
group 3 medulloblastoma 1.500 2.1e-03
nasopharyngeal carcinoma -2.500 2.7e-06
osteosarcoma -4.199 1.8e-09

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MSDPEGETLRSTFPSYMAEGERLYLCGEFSKAAQSFSNALYLQDGDKNCLVARSKCFLKMGDLERSLKDA      1 - 70
EASLQSDPAFCKGILQKAETLYTMGDFEFALVFYHRGYKLRPDREFRVGIQKAQEAINNSVGSPSSIKLE     71 - 140
NKGDLSFLSKQAENIKAQQKPQPMKHLLHPTKGEPKWKASLKSEKTVRQLLGELYVDKEYLEKLLLDEDL    141 - 210
IKGTMKGGLTVEDLIMTGINYLDTHSNFWRQQKPIYARERDRKLMQEKWLRDHKRRPSQTAHYILKSLED    211 - 280
IDMLLTSGSAEGSLQKAEKVLKKVLEWNKEEVPNKDELVGNLYSCIGNAQIELGQMEAALQSHRKDLEIA    281 - 350
KEYDLPDAKSRALDNIGRVFARVGKFQQAIDTWEEKIPLAKTTLEKTWLFHEIGRCYLELDQAWQAQNYG    351 - 420
EKSQQCAEEEGDIEWQLNASVLVAQAQVKLRDFESAVNNFEKALERAKLVHNNEAQQAIISALDDANKGI    421 - 490
IRELRKTNYVENLKEKSEGEASLYEDRIITREKDMRRVRDEPEKVVKQWDHSEDEKETDEDDEAFGEALQ    491 - 560
SPASGKQSVEAGKARSDLGAVAKGLSGELGTRSGETGRKLLEAGRRESREIYRRPSGELEQRLSGEFSRQ    561 - 630
EPEELKKLSEVGRREPEELGKTQFGEIGETKKTGNEMEKEYE                                631 - 672
//

Text Mined References (14)

PMID Year Title