Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.2e-03

Expression

AA Sequence

MEKPRLYQKYKISRVWWRLPVIPATREAEDNRLNPEGRGCGEPRSRHCTPAWTTTAKLHLKTIISLQPLN      1 - 70
MYQMEPGVGSIRTSPALQSPPALTRGPSAWDTAIRKALSFGVGLGVLVLVCLFYHFVTLAPILQFASLPC     71 - 140
LLEAGAQMSRHPVTTQVCIMPARLSLGSGISRNLLRLSVCHFTLLLPFRSLRPCPLSSRDMVLSYELWLL    141 - 210
CDFYIAPPDSSGSGICKKAI                                                      211 - 230
//

Text Mined References (3)

PMID Year Title