Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

AA Sequence

MEKPRLYQKYKISRVWWRLPVIPATREAEDNRLNPEGRGCGEPRSRHCTPAWTTTAKLHLKTIISLQPLN      1 - 70
MYQMEPGVGSIRTSPALQSPPALTRGPSAWDTAIRKALSFGVGLGVLVLVCLFYHFVTLAPILQFASLPC     71 - 140
LLEAGAQMSRHPVTTQVCIMPARLSLGSGISRNLLRLSVCHFTLLLPFRSLRPCPLSSRDMVLSYELWLL    141 - 210
CDFYIAPPDSSGSGICKKAI                                                      211 - 230
//

Text Mined References (3)

PMID Year Title
22500510 2012 Genetic analysis of the promoter region of the GATA4 gene in patients with ventricular septal defects.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.