Property Summary

NCBI Gene PubMed Count 21
PubMed Score 122.46
PubTator Score 124.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
ependymoma 2.000 1.0e-02
oligodendroglioma 1.100 5.0e-02
osteosarcoma 2.716 2.1e-03
Duchenne muscular dystrophy 1.094 5.2e-06
juvenile dermatomyositis 1.273 8.5e-11
adrenocortical carcinoma -1.278 2.3e-02
primary pancreatic ductal adenocarcinoma 1.953 5.1e-03
tuberculosis -1.600 2.0e-06
non-small cell lung cancer 1.978 8.4e-14
intraductal papillary-mucinous adenoma (... -1.500 2.0e-02
intraductal papillary-mucinous carcinoma... -1.500 4.5e-02
interstitial cystitis -1.300 5.3e-04
pilocytic astrocytoma 1.300 3.1e-04
sonic hedgehog group medulloblastoma 1.400 4.8e-03
aldosterone-producing adenoma -1.429 3.2e-02
subependymal giant cell astrocytoma -1.285 2.4e-02
Breast cancer -1.700 2.7e-08
breast carcinoma -1.200 1.3e-17
spina bifida -2.674 3.5e-02
gastric carcinoma 1.600 4.2e-02
ulcerative colitis 1.400 1.6e-03
ovarian cancer -3.300 1.2e-07
pituitary cancer -1.100 3.8e-03
pancreatic cancer 2.400 7.0e-03

Synonym

Accession Q96NE9 D3DSB9 Q5HYF2 Q8N2X1 Q8WUH7
Symbols EX1
Willin
C14orf31
c14_5320

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
22190428 Genome-wide and gene-based association implicates FRMD6 in Alzheimer disease.
21785462 Human homolog of Drosophila expanded, hEx, functions as a putative tumor suppressor in human cancer cell lines independently of the Hippo pathway
21666719 in mammalian cells willin influences Hippo signaling activity by activating the core Hippo pathway kinase cassette
16137681 Results describe a new FERM domain-containing protein called Willin.

AA Sequence

MNKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLSVIQNNEHVYM      1 - 70
ELSQKLYKYCPKEWKKEASKVRQYEVTWGIDQFGPPMIIHFRVQYYVENGRLISDRAARYYYYWHLRKQV     71 - 140
LHSQCVLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPEAYFPSWVVSKRGKDYILKHIPNMHKDQFAL    141 - 210
TASEAHLKYIKEAVRLDDVAVHYYRLYKDKREIEASLTLGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKL    211 - 280
VFVGKKFEILPDGLPSARKLIYYTGCPMRSRHLLQLLSNSHRLYMNLQPVLRHIRKLEENEEKKQYRESY    281 - 350
ISDNLDLDMDQLEKRSRASGSSAGSMKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDSYSSSAIHRK    351 - 420
LKTCSSMTSHGSSHTSGVESGGKDRLEEDLQDDEIEMLVDDPRDLEQMNEESLEVSPDMCIYITEDMLMS    421 - 490
RKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDRHSLSLDDIRLYQKDFLRIAG    491 - 560
LCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCINIQDAFPVKRTSKYFSLDLTHDEVPEFVV            561 - 622
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24658283 2014 A genome-wide gene-environment interaction analysis for tobacco smoke and lung cancer susceptibility.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22216198 2011 A genome-wide association study of the Protein C anticoagulant pathway.
22190428 2012 Genome-wide and gene-based association implicates FRMD6 in Alzheimer disease.
21785462 2012 Human homolog of Drosophila expanded, hEx, functions as a putative tumor suppressor in human cancer cell lines independently of the Hippo pathway.
21666719 2012 Willin/FRMD6 expression activates the Hippo signaling pathway kinases in mammals and antagonizes oncogenic YAP.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20171287 2010 Voxelwise genome-wide association study (vGWAS).
19668339 2009 Hippocampal atrophy as a quantitative trait in a genome-wide association study identifying novel susceptibility genes for Alzheimer's disease.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341207 2006 The tumour-suppressor genes NF2/Merlin and Expanded act through Hippo signalling to regulate cell proliferation and apoptosis.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16137681 2005 A novel 4.1 ezrin radixin moesin (FERM)-containing protein, 'Willin'.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.