Property Summary

NCBI Gene PubMed Count 21
Grant Count 13
R01 Count 2
Funding $1,958,715.55
PubMed Score 122.46
PubTator Score 124.38

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
22190428 Genome-wide and gene-based association implicates FRMD6 in Alzheimer disease.
21785462 Human homolog of Drosophila expanded, hEx, functions as a putative tumor suppressor in human cancer cell lines independently of the Hippo pathway
21666719 in mammalian cells willin influences Hippo signaling activity by activating the core Hippo pathway kinase cassette
16137681 Results describe a new FERM domain-containing protein called Willin.

AA Sequence

MNKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLSVIQNNEHVYM      1 - 70
ELSQKLYKYCPKEWKKEASKVRQYEVTWGIDQFGPPMIIHFRVQYYVENGRLISDRAARYYYYWHLRKQV     71 - 140
LHSQCVLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPEAYFPSWVVSKRGKDYILKHIPNMHKDQFAL    141 - 210
TASEAHLKYIKEAVRLDDVAVHYYRLYKDKREIEASLTLGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKL    211 - 280
VFVGKKFEILPDGLPSARKLIYYTGCPMRSRHLLQLLSNSHRLYMNLQPVLRHIRKLEENEEKKQYRESY    281 - 350
ISDNLDLDMDQLEKRSRASGSSAGSMKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDSYSSSAIHRK    351 - 420
LKTCSSMTSHGSSHTSGVESGGKDRLEEDLQDDEIEMLVDDPRDLEQMNEESLEVSPDMCIYITEDMLMS    421 - 490
RKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDRHSLSLDDIRLYQKDFLRIAG    491 - 560
LCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCINIQDAFPVKRTSKYFSLDLTHDEVPEFVV            561 - 622
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24658283 2014 A genome-wide gene-environment interaction analysis for tobacco smoke and lung cancer susceptibility.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22216198 2011 A genome-wide association study of the Protein C anticoagulant pathway.
22190428 2012 Genome-wide and gene-based association implicates FRMD6 in Alzheimer disease.
21785462 2012 Human homolog of Drosophila expanded, hEx, functions as a putative tumor suppressor in human cancer cell lines independently of the Hippo pathway.
21666719 2012 Willin/FRMD6 expression activates the Hippo signaling pathway kinases in mammals and antagonizes oncogenic YAP.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
More...