Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.13
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Fractures, Bone 13 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 3.0

Expression

  Differential Expression (7)

Disease log2 FC p
hereditary spastic paraplegia -1.049 2.1e-02
intraductal papillary-mucinous neoplasm ... 1.100 3.9e-03
non-small cell lung cancer 1.160 6.1e-12
osteosarcoma -1.443 2.0e-05
ovarian cancer 1.200 3.6e-05
spina bifida -2.503 3.0e-02
tuberculosis -1.200 1.3e-04

Gene RIF (1)

AA Sequence

MQWNVPRTVSRLARRTCLEPHNAGLFGHCQNVKGPLLLYNAESKVVLVQGPQKQWLHLSAAQCVAKERRP      1 - 70
LDAHPPQPGVLRHKQGKQHVSFRRVFSSSATAQGTPEKKEEPDPLQDKSISLYQRFKKTFRQYGKVLIPV     71 - 140
HLITSGVWFGTFYYAALKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTS    141 - 210
VTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQETKEKVSFKKKVE            211 - 272
//

Text Mined References (10)

PMID Year Title