Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 3.0e-06
medulloblastoma, large-cell 6241 1.5e-04
glioblastoma 5792 2.3e-04
ovarian cancer 8520 3.0e-03
Disease Target Count Z-score Confidence
Chondrosarcoma 21 3.43 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 3.0e-06
glioblastoma -1.100 2.3e-04
medulloblastoma, large-cell -1.100 1.5e-04
ovarian cancer 1.300 3.0e-03

AA Sequence

MASGSGTKNLDFRRKWDKDEYEKLAEKRLTEEREKKDGKPVQPVKRELLRHRDYKVDLESKLGKTIVITK      1 - 70
TTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQVKKRFEVNKKKMEEKQKDY     71 - 140
DFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY               141 - 199
//

Text Mined References (12)

PMID Year Title