Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.06
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.026
group 3 medulloblastoma 1.300 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q96NB3 Q96F60 Q96GZ5 Q9BU38
Symbols OMCG1
CCDC16

Gene

Gene RIF (1)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASSASARTPAGKRVINQEELRRLMKEKQRLSTSRKRIESPFAKYNRLGQLSCALCNTPVKSELLWQTHV      1 - 70
LGKQHREKVAELKGAKEASQGSSASSAPHSVKRKAPDADDQDVKRAKATLVPQVQPSTSAWTTNFDKIGK     71 - 140
EFIRATPSKPSGLSLLPDYEDEEEEEEEEEGDGERKRGDASKPLSDAQGKEHSVSSSREVTSSVLPNDFF    141 - 210
STNPPKAPIIPHSGSIEKAEIHEKVVERRENTAEALPEGFFDDPEVDARVRKVDAPKDQMDKEWDEFQKA    211 - 280
MRQVNTISEAIVAEEDEEGRLDRQIGEIDEQIECYRRVEKLRNRQDEIKNKLKEILTIKELQKKEEENAD    281 - 350
SDDEGELQDLLSQDWRVKGALL                                                    351 - 372
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23066043 2013 "Orphan" retrogenes in the human genome.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...