Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.56
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.6e-05
group 3 medulloblastoma 4104 7.1e-05
Rheumatoid arthritis 1191 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Xeroderma pigmentosum group A 4 3.867 1.9
Cockayne syndrome 60 3.554 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.200 7.1e-05
ovarian cancer -1.300 1.6e-05
Rheumatoid arthritis -1.100 2.6e-02

Gene RIF (1)

AA Sequence

MASSASARTPAGKRVINQEELRRLMKEKQRLSTSRKRIESPFAKYNRLGQLSCALCNTPVKSELLWQTHV      1 - 70
LGKQHREKVAELKGAKEASQGSSASSAPHSVKRKAPDADDQDVKRAKATLVPQVQPSTSAWTTNFDKIGK     71 - 140
EFIRATPSKPSGLSLLPDYEDEEEEEEEEEGDGERKRGDASKPLSDAQGKEHSVSSSREVTSSVLPNDFF    141 - 210
STNPPKAPIIPHSGSIEKAEIHEKVVERRENTAEALPEGFFDDPEVDARVRKVDAPKDQMDKEWDEFQKA    211 - 280
MRQVNTISEAIVAEEDEEGRLDRQIGEIDEQIECYRRVEKLRNRQDEIKNKLKEILTIKELQKKEEENAD    281 - 350
SDDEGELQDLLSQDWRVKGALL                                                    351 - 372
//

Text Mined References (22)

PMID Year Title