Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.65
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
medulloblastoma, large-cell 6241 6.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.100 6.2e-04

Gene RIF (2)

AA Sequence

MSYGSIARGGGLGSRGPFGGPSRQGCQPLECARCWTEYGIRHFPCPSPESKLQNRCVGKDGEGDLGPAGT      1 - 70
PIVPRARKRGPGVAPEGSRMPEPTSSPTIGPRKDSAAGPHGRMAGPSTTRAKKRKPNFCPQETEVLVSKV     71 - 140
SKHHQLLFGTGLLKAEPTRRYRVWSRILQAVNALGYCRRDVVDLKHKWRDLRAVVRRKLGDLRKAAHGPS    141 - 210
PGSGKPQALALTPVEQVVAKTFSCQALPSEGFSLEPPRATQVDPCNLQELFQEMSANVFRINSSVTSLER    211 - 280
SLQSLGTPSDTQELRDSLHTAQQETNKTIAASASSVKQMAELLRSSCPQERLQQERPQLDRLKTQLSDAI    281 - 350
QCYGVVQKKIAEKSRALLPMAQRGSKQSPQAPFAELADDEKVFNGSDNMWQGQEQALLPDITEEDLEAIR    351 - 420
LREEAILQMESNLLDVNQIIKDLASMVSEQGEAVDSIEASLEAASSHAEAARQLLAGASRHQLQRHKIKC    421 - 490
CFLSAGVTALLVIIIIIATSVRK                                                   491 - 513
//

Text Mined References (10)

PMID Year Title