Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.56
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.001

Synonym

Accession Q96NA8 B7ZLB0 Q14D03
Symbols

Gene

Gene RIF (2)

PMID Text
25471352 Study provides the first evidence that the minor allele of TSNARE1 rs10098073 is significantly associated with a reduced risk of schizophrenia in a Han Chinese population, suggesting TSNARE1 may represent a susceptibility gene for this disease
24166486 GWAS meta analysis identifies TSNARE1 as a novel Schizophrenia / Bipolar susceptibility locus

AA Sequence

MSYGSIARGGGLGSRGPFGGPSRQGCQPLECARCWTEYGIRHFPCPSPESKLQNRCVGKDGEGDLGPAGT      1 - 70
PIVPRARKRGPGVAPEGSRMPEPTSSPTIGPRKDSAAGPHGRMAGPSTTRAKKRKPNFCPQETEVLVSKV     71 - 140
SKHHQLLFGTGLLKAEPTRRYRVWSRILQAVNALGYCRRDVVDLKHKWRDLRAVVRRKLGDLRKAAHGPS    141 - 210
PGSGKPQALALTPVEQVVAKTFSCQALPSEGFSLEPPRATQVDPCNLQELFQEMSANVFRINSSVTSLER    211 - 280
SLQSLGTPSDTQELRDSLHTAQQETNKTIAASASSVKQMAELLRSSCPQERLQQERPQLDRLKTQLSDAI    281 - 350
QCYGVVQKKIAEKSRALLPMAQRGSKQSPQAPFAELADDEKVFNGSDNMWQGQEQALLPDITEEDLEAIR    351 - 420
LREEAILQMESNLLDVNQIIKDLASMVSEQGEAVDSIEASLEAASSHAEAARQLLAGASRHQLQRHKIKC    421 - 490
CFLSAGVTALLVIIIIIATSVRK                                                   491 - 513
//

Text Mined References (10)

PMID Year Title
25471352 2015 TSNARE1 polymorphisms are associated with schizophrenia susceptibility in Han Chinese.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24166486 2013 GWAS meta analysis identifies TSNARE1 as a novel Schizophrenia / Bipolar susceptibility locus.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.