Property Summary

NCBI Gene PubMed Count 34
Grant Count 12
R01 Count 4
Funding $1,188,225.63
PubMed Score 10.98
PubTator Score 40.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
breast carcinoma 1,614
fibroadenoma 557

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma -1.300 0.001
fibroadenoma -1.500 0.020

Gene RIF (19)

PMID Text
26469971 RILP suppresses the invasion of breast cancer cells by interacting with RalGDS to inhibit its guanine nucleotide exchange factor activity for RalA.
26180254 RILP regulates vacuolar ATPase through interaction with the V1G1 subunit
25445562 VPS41 subunit of HOPS complex was defined to be the major partner for interacting with RILP.
24762812 RILP regulates the activity of the V-ATPase through its interaction with V1G1.
23729732 RILP directly and concomitantly binds the tethering HOPS complex and the p150(Glued) subunit of the dynein motor. ORP1L then functions as a cholesterol-sensing switch controlling RILP-HOPS-p150(Glued) interactions.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20012524 Rab7 and RILP direct endosome-associated HIV-1 Gag towards the microtubule-organizing center (MTOC)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19564404 Results describe how ORP1L contacts VAP to control Rab7-RILP-p150 Glued and late endosome positioning.
More...

AA Sequence

MEPRRAAPGVPGWGSREAAGSASAAELVYHLAGALGTELQDLARRFGPEAAAGLVPLVVRALELLEQAAV      1 - 70
GPAPDSLQVSAQPAEQELRRLREENERLRRELRAGPQEERALLRQLKEVTDRQRDELRAHNRDLRQRGQE     71 - 140
TEALQEQLQRLLLVNAELRHKLAAMQTQLRAAQDRERERQQPGEAATPQAKERARGQAGRPGHQHGQEPE    141 - 210
WATAGAGAPGNPEDPAEAAQQLGRPSEAGQCRFSREEFEQILQERNELKAKVFLLKEELAYFQRELLTDH    211 - 280
RVPGLLLEAMKVAVRKQRKKIKAKMLGTPEEAESSEDEAGPWILLSDDKGDHPPPPESKIQSFFGLWYRG    281 - 350
KAESSEDETSSPAPSKLGGEEEAQPQSPAPDPPCSALHEHLCLGASAAPEA                       351 - 401
//

Text Mined References (37)

PMID Year Title
26911690 2016 Parkin Modulates Endosomal Organization and Function of the Endo-Lysosomal Pathway.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26469971 2015 RILP suppresses invasion of breast cancer cells by modulating the activity of RalA through interaction with RalGDS.
26180254 2015 RILP regulates vacuolar ATPase through interaction with the V1G1 subunit.
25445562 2014 RILP interacts with HOPS complex via VPS41 subunit to regulate endocytic trafficking.
25272277 2014 A Ras-like domain in the light intermediate chain bridges the dynein motor to a cargo-binding region.
24762812 2014 RILP regulates vacuolar ATPase through interaction with the V1G1 subunit.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23729732 2013 Late endosomal transport and tethering are coupled processes controlled by RILP and the cholesterol sensor ORP1L.
22431521 2012 The role of ceroid lipofuscinosis neuronal protein 5 (CLN5) in endosomal sorting.
More...