Property Summary

NCBI Gene PubMed Count 34
PubMed Score 12.24
PubTator Score 40.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
breast carcinoma 1638 6.6e-04
fibroadenoma 559 2.0e-02
Disease Target Count Z-score Confidence
Charcot-Marie-Tooth disease type 2B 6 4.362 2.2

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma -1.300 6.6e-04
fibroadenoma -1.500 2.0e-02

Gene RIF (19)

AA Sequence

MEPRRAAPGVPGWGSREAAGSASAAELVYHLAGALGTELQDLARRFGPEAAAGLVPLVVRALELLEQAAV      1 - 70
GPAPDSLQVSAQPAEQELRRLREENERLRRELRAGPQEERALLRQLKEVTDRQRDELRAHNRDLRQRGQE     71 - 140
TEALQEQLQRLLLVNAELRHKLAAMQTQLRAAQDRERERQQPGEAATPQAKERARGQAGRPGHQHGQEPE    141 - 210
WATAGAGAPGNPEDPAEAAQQLGRPSEAGQCRFSREEFEQILQERNELKAKVFLLKEELAYFQRELLTDH    211 - 280
RVPGLLLEAMKVAVRKQRKKIKAKMLGTPEEAESSEDEAGPWILLSDDKGDHPPPPESKIQSFFGLWYRG    281 - 350
KAESSEDETSSPAPSKLGGEEEAQPQSPAPDPPCSALHEHLCLGASAAPEA                       351 - 401
//

Text Mined References (37)

PMID Year Title