Property Summary

NCBI Gene PubMed Count 19
Grant Count 6
R01 Count 4
Funding $416,047.99
PubMed Score 6.11
PubTator Score 9.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (6)

PMID Text
24874604 Phosphorylation of S106 modulates Asef2 guanine nucleotide exchange factor activity and Asef2-mediated cell migration and adhesion turnover.
24144700 A new role for Rac activation, promoted by Asef2, in modulating actomyosin contractility.
19934221 Asef2 activates Rac1 to modulate adhesion and actin dynamics and thereby regulate cell migration.
19910543 Observational study of gene-disease association. (HuGE Navigator)
19151759 Asef2, Neurabin2 and APC cooperatively regulate actin cytoskeletal organization and are required for HGF-induced cell migration.
17599059 These results suggest that similar to Asef, Asef2 plays an important role in cell migration, and that Asef2 activated by truncated mutant APC is required for aberrant migration of colorectal tumor cells.

AA Sequence

MTSASPEDQNAPVGCPKGARRRRPISVIGGVSLYGTNQTEELDNLLTQPASRPPMPAHQVPPYKAVSARF      1 - 70
RPFTFSQSTPIGLDRVGRRRQMRASNVSSDGGTEPSALVDDNGSEEDFSYEDLCQASPRYLQPGGEQLAI     71 - 140
NELISDGNVVCAEALWDHVTMDDQELGFKAGDVIQVLEASNKDWWWGRSEDKEAWFPASFVRLRVNQEEL    141 - 210
SENSSSTPSEEQDEEASQSRHRHCENKQQMRTNVIREIMDTERVYIKHLRDICEGYIRQCRKHTGMFTVA    211 - 280
QLATIFGNIEDIYKFQRKFLKDLEKQYNKEEPHLSEIGSCFLQNQEGFAIYSEYCNNHPGACLELANLMK    281 - 350
QGKYRHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTTQEHGDYSNIKAAYEAMKNVACL    351 - 420
INERKRKLESIDKIARWQVSIVGWEGLDILDRSSELIHSGELTKITKQGKSQQRTFFLFDHQLVSCKKDL    421 - 490
LRRDMLYYKGRLDMDEMELVDLGDGRDKDCNLSVKNAFKLVSRTTDEVYLFCAKKQEDKARWLQACADER    491 - 560
RRVQEDKEMGMEISENQKKLAMLNAQKAGHGKSKGYNRCPVAPPHQGLHPIHQRHITMPTSVPQQQVFGL    561 - 630
AEPKRKSSLFWHTFNRLTPFRK                                                    631 - 652
//

Text Mined References (20)

PMID Year Title
24874604 2014 Phosphorylation of serine 106 in Asef2 regulates cell migration and adhesion turnover.
24623842 2014 GABRA1 and STXBP1: novel genetic causes of Dravet syndrome.
24144700 2013 Activation of Rac by Asef2 promotes myosin II-dependent contractility to inhibit cell migration on type I collagen.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
22419666 2012 Genome wide study of maternal and parent-of-origin effects on the etiology of orofacial clefts.
22064162 2012 Genome-wide association study of comorbid depressive syndrome and alcohol dependence.
19934221 2009 The Rho-family GEF Asef2 activates Rac to modulate adhesion and actin dynamics and thereby regulate cell migration.
19910543 2010 Confirmation of genomewide association signals in Chinese Han population reveals risk loci for ischemic stroke.
19893577 2009 The adenomatous polyposis coli-associated exchange factors Asef and Asef2 are required for adenoma formation in Apc(Min/+)mice.
19151759 2009 Asef2 and Neurabin2 cooperatively regulate actin cytoskeletal organization and are involved in HGF-induced cell migration.
More...