Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.11
PubTator Score 9.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
aldosterone-producing adenoma -1.029 3.9e-02
Astrocytoma, Pilocytic 1.700 3.2e-07
ependymoma 1.400 2.4e-09
glioblastoma 1.200 5.9e-05
group 3 medulloblastoma -1.400 8.4e-03
interstitial cystitis 1.300 1.9e-03
juvenile dermatomyositis 1.268 3.3e-09
medulloblastoma, large-cell -1.200 1.9e-03
non-small cell lung cancer -1.410 6.3e-19
osteosarcoma 1.660 2.2e-08
ovarian cancer 1.400 1.6e-02
pediatric high grade glioma 1.100 1.3e-04
primary Sjogren syndrome 1.300 5.0e-03
progressive supranuclear palsy -1.100 3.9e-02

Protein-protein Interaction (7)

Gene RIF (6)

AA Sequence

MTSASPEDQNAPVGCPKGARRRRPISVIGGVSLYGTNQTEELDNLLTQPASRPPMPAHQVPPYKAVSARF      1 - 70
RPFTFSQSTPIGLDRVGRRRQMRASNVSSDGGTEPSALVDDNGSEEDFSYEDLCQASPRYLQPGGEQLAI     71 - 140
NELISDGNVVCAEALWDHVTMDDQELGFKAGDVIQVLEASNKDWWWGRSEDKEAWFPASFVRLRVNQEEL    141 - 210
SENSSSTPSEEQDEEASQSRHRHCENKQQMRTNVIREIMDTERVYIKHLRDICEGYIRQCRKHTGMFTVA    211 - 280
QLATIFGNIEDIYKFQRKFLKDLEKQYNKEEPHLSEIGSCFLQNQEGFAIYSEYCNNHPGACLELANLMK    281 - 350
QGKYRHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTTQEHGDYSNIKAAYEAMKNVACL    351 - 420
INERKRKLESIDKIARWQVSIVGWEGLDILDRSSELIHSGELTKITKQGKSQQRTFFLFDHQLVSCKKDL    421 - 490
LRRDMLYYKGRLDMDEMELVDLGDGRDKDCNLSVKNAFKLVSRTTDEVYLFCAKKQEDKARWLQACADER    491 - 560
RRVQEDKEMGMEISENQKKLAMLNAQKAGHGKSKGYNRCPVAPPHQGLHPIHQRHITMPTSVPQQQVFGL    561 - 630
AEPKRKSSLFWHTFNRLTPFRK                                                    631 - 652
//

Text Mined References (20)

PMID Year Title