Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.99
PubTator Score 2.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (1)

PMID Text
24445935 ZNF396 might repress Notch-Hes1 signaling axis and prevent tumor cells from undergoing squamous differentiation in basal cell carcinoma.

AA Sequence

MSAKLGKSSSLLTQTSEECNGILTEKMEEEEQTCDPDSSLHWSSSYSPETFRQQFRQFGYQDSPGPHEAL      1 - 70
SRLWELCHLWLRPEVHTKEQILELLVLEQFLAILPKELQAWVQKHHPENGEETVTMLEDVERELDGPKQI     71 - 140
FFGRRKDMIAEKLAPSEITEELPSSQLMPVKKQLQGASWELQSLRPHDEDIKTTNVKSASRQKTSLGIEL    141 - 210
HCNVSNILHMNGSQSSTYRGTYEQDGRFEKRQGNPSWKKQQKCDECGKIFSQSSALILHQRIHSGKKPYA    211 - 280
CDECAKAFSRSAILIQHRRTHTGEKPYKCHDCGKAFSQSSNLFRHRKRHIRKKVP                   281 - 335
//

Text Mined References (7)

PMID Year Title
24445935 2014 Expression of ZNF396 in basal cell carcinoma.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12801647 2003 Identification and characterization of two novel human SCAN domain-containing zinc finger genes ZNF396 and ZNF397.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.