Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.99
PubTator Score 2.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 4.4e-04
ependymoma 1.100 4.4e-02
group 4 medulloblastoma 1.300 2.0e-06
primitive neuroectodermal tumor 1.300 3.2e-02

Gene RIF (1)

AA Sequence

MSAKLGKSSSLLTQTSEECNGILTEKMEEEEQTCDPDSSLHWSSSYSPETFRQQFRQFGYQDSPGPHEAL      1 - 70
SRLWELCHLWLRPEVHTKEQILELLVLEQFLAILPKELQAWVQKHHPENGEETVTMLEDVERELDGPKQI     71 - 140
FFGRRKDMIAEKLAPSEITEELPSSQLMPVKKQLQGASWELQSLRPHDEDIKTTNVKSASRQKTSLGIEL    141 - 210
HCNVSNILHMNGSQSSTYRGTYEQDGRFEKRQGNPSWKKQQKCDECGKIFSQSSALILHQRIHSGKKPYA    211 - 280
CDECAKAFSRSAILIQHRRTHTGEKPYKCHDCGKAFSQSSNLFRHRKRHIRKKVP                   281 - 335
//

Text Mined References (7)

PMID Year Title