Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.17
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Major Depressive Disorder 301 3.051 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.300 2.9e-03
interstitial lung disease 1.200 9.6e-03
osteosarcoma 1.841 3.7e-06
ovarian cancer -1.900 1.5e-14
Pick disease 1.100 1.1e-03
tuberculosis and treatment for 6 months -1.200 1.6e-04

AA Sequence

MQAEDRSQFGSAAEMLSEQTAALGTGWESMNVQLDGAEPQVERGSQEERPWRTVPGPLEHLCCDLEEEPQ      1 - 70
SLQEKAQSAPWVPAIPQEGNTGDWEMAAALLAAGSQGLVTIKDVSLCFSQEEWRSLDPSQTDFYGEYVMQ     71 - 140
ENCGIVVSLRFPIPKLDMLSQLEGGEEQWVPDPQDLEERDILRVTYTGDGSEHEGDTPELEAEPPRMLSS    141 - 210
VSEDTVLWNPEHDESWDSMPSSSRGMLLGPPFLQEDSFSNLLCSTEMDSLLRPHTCPQCGKQFVWGSHLA    211 - 280
RHQQTHTGERPYSCLKCEKTFGRRHHLIRHQKTHLHDKTSRCSECGKNFRCNSHLASHQRVHAEGKSCKG    281 - 350
QEVGESPGTRKRQRAPPVPKCHVCTECGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLL    351 - 420
THQGQSPRNSWDRGTSVF                                                        421 - 438
//

Text Mined References (9)

PMID Year Title