Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 4.45831546478125E-4



Accession Q96N68
Symbols HsT3231


 Compartment GO Term (0)

AA Sequence

ACVYVCMCVLVCMCACACMRAHRYFLMDCAGICSPHGPGTQ                                 141 - 181

Text Mined References (1)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.