Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

Synonym

Accession Q96N68
Symbols HsT3231

Gene

 Compartment GO Term (0)

AA Sequence

MQGQGALKESHIHLPTEQPEASLVLQGQLAESSALGPKGALRPQAQSPDVPVSWWQGSGKRLSHRLPHIC      1 - 70
SQPPLGPFLPLTWPSCGFFGLGGAASASLGLEVLQDSVSTWARGPCCPVHPQSLTVVCMCACMCVCVHVC     71 - 140
ACVYVCMCVLVCMCACACMRAHRYFLMDCAGICSPHGPGTQ                                 141 - 181
//

Text Mined References (1)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.