Property Summary

NCBI Gene PubMed Count 39
PubMed Score 15.24
PubTator Score 10.63

Knowledge Summary


No data available


  Disease Sources (6)

Disease Target Count P-value
glioblastoma multiforme 347 1.72955286125252E-19
nasopharyngeal carcinoma 1056 1.97462038110006E-4
osteosarcoma 7933 4.47019787528661E-4
group 3 medulloblastoma 2254 5.9981968618141E-4
oligodendroglioma 2849 0.00109428252102038
ovarian cancer 8492 0.00356664097855762
astrocytic glioma 2241 0.00764827942687921
ependymoma 2514 0.0206065517871114
Breast cancer 3099 0.0301388007076906
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Epilepsy 346 0.0 4.0
Disease Target Count Z-score Confidence
Cortical blindness 15 3.742 1.9


  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.300 0.008
ependymoma 1.600 0.021
oligodendroglioma -1.400 0.001
glioblastoma multiforme 1.200 0.000
osteosarcoma 1.683 0.000
group 3 medulloblastoma 1.400 0.001
Breast cancer 2.400 0.030
nasopharyngeal carcinoma 1.100 0.000
ovarian cancer 1.800 0.004

Gene RIF (12)

27018747 Interaction of myosin VI and its binding partner DOCK7 plays an important role in NGF-stimulated protrusion formation in PC12 cells.
24814191 These observations suggest that loss of DOCK7 function causes a syndromic form of epileptic encephalopathy by affecting multiple neuronal processes.
24518591 Dock7 mediates serum- and HGF-induced glioblastoma cell invasion.
23718289 The action of DOCK7 in vivo may involve the coordinated integration of Cdc42/Rac signaling in the context of the membrane recruitment of a DOCK7 guanine nucleotide exchange factor (GEF) complex.
23254359 DOCK7 functions as an essential and downstream regulator of RAGE-mediated cellular migration through the formation of dendritic pseudopodia.
20972250 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

LKEALQPLINRKIPQLYKAVLPVTCHRDSFSRMSLRKMDL                                 2101 - 2140

Text Mined References (51)

PMID Year Title
27018747 2016 Interaction of myosin VI and its binding partner DOCK7 plays an important role in NGF-stimulated protrusion formation in PC12 cells.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24814191 2014 Mutations in DOCK7 in individuals with epileptic encephalopathy and cortical blindness.
24518591 2014 Guanine nucleotide exchange factor Dock7 mediates HGF-induced glioblastoma cell invasion via Rac activation.
24386095 2013 A genome wide association study identifies common variants associated with lipid levels in the Chinese population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23718289 2013 Prenylation and membrane localization of Cdc42 are essential for activation by DOCK7.
23254359 2013 DOCK7 is a critical regulator of the RAGE-Cdc42 signaling axis that induces formation of dendritic pseudopodia in human cancer cells.