Property Summary

NCBI Gene PubMed Count 15
Grant Count 14
R01 Count 9
Funding $1,234,324.88
PubMed Score 18.12
PubTator Score 4.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis 1.400 0.000
group 3 medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.200 0.001
lung cancer 1.300 0.036
invasive ductal carcinoma 1.300 0.001

 GWAS Trait (1)

Gene RIF (6)

PMID Text
26482880 Variants in the MBOAT7 gene is associated with alcohol-related cirrhosis.
23510452 ssSPTa is identified as an LPIAT1-interacting protein.
18931347 reviews members of the MBOAT family
18772128 MBOAT5 and MBOAT7 in arachidonate recycling, thus regulating free arachidonic acid levels and leukotriene synthesis in neutrophils
18094042 describes the cloning of human MBOAT7
10941842 LENG4 is located in the leukocyte receptor cluster on chromosome 19.

AA Sequence

MSPEEWTYLVVLLISIPIGFLFKKAGPGLKRWGAAAVGLGLTLFTCGPHTLHSLVTILGTWALIQAQPCS      1 - 70
CHALALAWTFSYLLFFRALSLLGLPTPTPFTNAVQLLLTLKLVSLASEVQDLHLAQRKEMASGFSKGPTL     71 - 140
GLLPDVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQPFPGAVPSLRPLLRRAWPAPLFGLLFLLSSH    141 - 210
LFPLEAVREDAFYARPLPARLFYMIPVFFAFRMRFYVAWIAAECGCIAAGFGAYPVAAKARAGGGPTLQC    211 - 280
PPPSSPEKAASLEYDYETIRNIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLRSAWTML    281 - 350
LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHWFLKMRAYDYMCMGFVLLSLA    351 - 420
DTLRYWASIYFCIHFLALAALGLGLALGGGSPSRRKAASQPTSLAPEKLREE                      421 - 472
//

Text Mined References (19)

PMID Year Title
26482880 2015 A genome-wide association study confirms PNPLA3 and identifies TM6SF2 and MBOAT7 as risk loci for alcohol-related cirrhosis.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23510452 2013 Identification of small subunit of serine palmitoyltransferase a as a lysophosphatidylinositol acyltransferase 1-interacting protein.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
18931347 2009 Recent progress on acyl CoA: lysophospholipid acyltransferase research.
18772128 2008 Lysophospholipid acyltransferases and arachidonate recycling in human neutrophils.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...