Property Summary

NCBI Gene PubMed Count 20
PubMed Score 19.35
PubTator Score 4.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Fatty liver disease 103 4.287 2.1
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0
Disease Target Count Z-score Confidence
Liver Cirrhosis 181 3.12 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma -1.400 1.7e-04
invasive ductal carcinoma 1.300 6.7e-04
lung cancer 1.300 3.6e-02
malignant mesothelioma 1.100 4.3e-05
medulloblastoma, large-cell -1.200 8.5e-04
psoriasis 1.400 2.8e-04

Gene RIF (11)

AA Sequence

MSPEEWTYLVVLLISIPIGFLFKKAGPGLKRWGAAAVGLGLTLFTCGPHTLHSLVTILGTWALIQAQPCS      1 - 70
CHALALAWTFSYLLFFRALSLLGLPTPTPFTNAVQLLLTLKLVSLASEVQDLHLAQRKEMASGFSKGPTL     71 - 140
GLLPDVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQPFPGAVPSLRPLLRRAWPAPLFGLLFLLSSH    141 - 210
LFPLEAVREDAFYARPLPARLFYMIPVFFAFRMRFYVAWIAAECGCIAAGFGAYPVAAKARAGGGPTLQC    211 - 280
PPPSSPEKAASLEYDYETIRNIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLRSAWTML    281 - 350
LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHWFLKMRAYDYMCMGFVLLSLA    351 - 420
DTLRYWASIYFCIHFLALAALGLGLALGGGSPSRRKAASQPTSLAPEKLREE                      421 - 472
//

Text Mined References (24)

PMID Year Title