Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.701 0.001
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.100 0.001
medulloblastoma 1.100 0.007
medulloblastoma, large-cell 1.100 0.000
non primary Sjogren syndrome sicca -1.400 0.019
Breast cancer -1.300 0.000

AA Sequence

MLHEEAAQKRKGKEPGMALPQGRLTFRDVAIEFSLAEWKFLNPAQRALYREVMLENYRNLEAVDISSKRM      1 - 70
MKEVLSTGQGNTEVIHTGMLQRHESYHTGDFCFQEIEKDIHDFEFQSQKDERNGHEASMPKIKELMGSTD     71 - 140
RHDQRHAGNKPIKDQLGLSFHLHLPELHIFQPEEKIANQVEKSVNDASSISTSQRISCRPETHTPNNYGN    141 - 210
NFFHSSLLTQKQEVHMREKSFQCNETGEAFNCSSFVRKHQIIHLGEKQYKFDICGKVFNEKRYLARHRRC    211 - 280
HTSEKPYKCNECGKSFSYKSSLTCHRRCHTGEKPYKCNECGKSFSYKSSLTCHHRCHTGEKPYKCNECGK    281 - 350
SFSYKSSLRCHRRLHTGIKPYKCNECGKMFGQNSTLVIHKAIHTGEKPYKCNECGKAFNQQSHLSRHHRL    351 - 420
HTGEKPYKCNDCGKAFIHQSSLARHHRLHTGEKSYKCEECDRVFSQKSNLERHKIIHTGEKPYKCNECHK    421 - 490
TFSHRSSLPCHRRLHSGEKPYKCNECGKTFNVQSHLSRHHRLHTGEKPYKCKVCDKAFMCHSYLANHTRI    491 - 560
HSGEKPYKCNECGKAHNHLIDSSIKPCMSS                                            561 - 590
//

Text Mined References (3)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.