Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96N53 B2RP80
Symbols C11orf37
NCRNA00167

Gene

 Compartment GO Term (0)

AA Sequence

MTEGLFISCSAVRVKPNRRAGLRRRSPAFLLSANQKTRLFALGSSPRCGPRANGEEASSCAWVSRAPRAA      1 - 70
CARAKPASRAPEGPVSRKTRGGEAALASARPATDCLRSGLAVERRRKPNSRPAPGVGSLPGSRPQDPQGA     71 - 140
AGRRLSP                                                                   141 - 147
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.