Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96N53 B2RP80
Symbols C11orf37
NCRNA00167

 Compartment GO Term (0)

AA Sequence

MTEGLFISCSAVRVKPNRRAGLRRRSPAFLLSANQKTRLFALGSSPRCGPRANGEEASSCAWVSRAPRAA      1 - 70
CARAKPASRAPEGPVSRKTRGGEAALASARPATDCLRSGLAVERRRKPNSRPAPGVGSLPGSRPQDPQGA     71 - 140
AGRRLSP                                                                   141 - 147
//

Text Mined References (3)

PMID Year Title