Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

Synonym

Accession Q96N35
Symbols TMEM83
NCRNA00052

Gene

 Compartment GO Term (0)

AA Sequence

MNCDALLHHSAIPEDFLHIFLLLQKISVSLPLSLSQSVCLFYSISLCVSLLLHISLCVSVYVSLSLSSFP      1 - 70
CFSLTHTHTHSQLSKDTSVLTFTFCFKQHTHFTLNYTSHAHELSAPSVHPTCVFTFKAAPSPRPAT         71 - 136
//

Text Mined References (3)

PMID Year Title
23594818 2013 Evidence for shared genetic risk between methamphetamine-induced psychosis and schizophrenia.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.