Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.32
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Breast cancer 3,094
lung cancer 4,466

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.500 0.001
Breast cancer 1.300 0.000

Synonym

Accession Q96N28 B0YJ10 B4E0C9 D3DUJ1 Q6AHX2
Symbols SLMO1
C18orf43
HFL-EDDG1

Gene

PDB

4XZV  

Gene RIF (2)

PMID Text
26071602 crystal structures of free TRIAP1 and TRIAP1-SLMO1 complex reveal how the PRELI domain is chaperoned during import into the intermembrane mitochondrial space; structural resemblance of PRELI-like domain of SLMO1 with that of mammalian phoshatidylinositol transfer proteins suggest they share similar lipid transfer mechanisms
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKIWSSEHVFGHPWDTVIQAAMRKYPNPMNPSVLGVDVLQRRVDGRGRLHSLRLLSTEWGLPSLVRAILG      1 - 70
TSRTLTYIREHSVVDPVEKKMELCSTNITLTNLVSVNERLVYTPHPENPEMTVLTQEAIITVKGISLGSY     71 - 140
LESLMANTISSNAKKGWAAIEWIIEHSESAVS                                          141 - 172
//

Text Mined References (9)

PMID Year Title
26071602 2015 Structural insight into the TRIAP1/PRELI-like domain family of mitochondrial phospholipid transfer complexes.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.