Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.32
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 1.6e-04
lung cancer 4740 5.4e-04

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 1.300 1.6e-04
lung cancer 1.500 5.4e-04

Gene RIF (2)

AA Sequence

MKIWSSEHVFGHPWDTVIQAAMRKYPNPMNPSVLGVDVLQRRVDGRGRLHSLRLLSTEWGLPSLVRAILG      1 - 70
TSRTLTYIREHSVVDPVEKKMELCSTNITLTNLVSVNERLVYTPHPENPEMTVLTQEAIITVKGISLGSY     71 - 140
LESLMANTISSNAKKGWAAIEWIIEHSESAVS                                          141 - 172
//

Text Mined References (9)

PMID Year Title