Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.36
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 2.100 0.034
lung adenocarcinoma -1.100 0.000
non primary Sjogren syndrome sicca -1.100 0.024
lung carcinoma -1.900 0.000

Synonym

Accession Q96N23 E9PJL5 Q6ZTY8
Symbols C12orf55
C12orf63

Gene

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAAQGSPSSSPSDDSTTSGSLPELPPTSTATSRSPPESKGSSRSSLLQWTCPEDSLPLAVFYGPLDAKNP      1 - 70
LLASCEKEIQELLGFMRKKKALATTEEEKHEFRRRCATSLFNIWTKYAPRLPADYYNEKLLKVGDSLCQM     71 - 140
KEYKLALLQCYGRYLQQFNTNFDENKVDVTQFKATFFPKGFKDKTAGLTFHALSGKNMCNYQLVCDSDEN    141 - 210
LKNKESVVQCLHILSSLRLIMQVALPQEHLCWIIFNGTIYIYTICRKLMVIGQSSKALEYLLWASMCMES    211 - 280
LVPLLSLRYLTWRATLYTAVCQCCYDCHAGIHGEAFARRALAKIDELRQLELMSSSKSQEESRRYFREAT    281 - 350
MKMAVMIFKRGVFESRRKNKAVFRPKIRINLREVQTLSWPRTVTERLLDEMFDSTASQFLAVLEALSDSN    351 - 420
RRILQTGPIVTDEVEIHDVVSELFMAGKELLIMSNIGADGMLDFPKTSLLELMIGRKDVISVDAAVKFIK    421 - 490
LAFTYEEWSLFESSAVHLIYFLQRQDDPESKKAEKDLTLLIAMEPLINVKRNKGLIFPLENYKEGQSTQI    491 - 560
YLKKIAVHDTCLKTCGYSEDIFHLAATLYVCVCTAPQDVQPDKEIVVDTIMFLWQKCKLGIQRLNISRND    561 - 630
YAKFTQKISTNKWIYLLWQINEVIHCYKMEDIDIVVVAEVTLRLSEILESLGSPGRKFKQSLDVPLREGT    631 - 700
NKFPGAPKGITEILPILQKNPVEQLLFAYKLLDRAIGGINLNCMLTSLPNGSSVIDHCYAKRTHHIDGDT    701 - 770
YKPLASNSFMMDLHLELIQAQHRIAVVLLDKLQVLQTPTVSKDISTKGPEKLKQSGSTDCFTELNIMNKI    771 - 840
KKNTLSKAIYLMQKALLIFEKDATSTSSWELLMEAYSLIQRIEAEQNALYSYQKYLESSKRKKSRVPPPP    841 - 910
ILLSRTHCSVTLKPAPFTSEVKVSWYCILGCKAEGSYGKVRLNNNHLPNSGEAIPADGKSVFEVKGLETN    911 - 980
EKYVFAVAAYSNNGKLVGGAIGETTKPILVYPPLSTITARMFLTQVAYQVGNYELAKKVFSPVWDYFVAS    981 - 1050
PLQDEQSVICLSNIITITQRRLHSDILAETSSILLYLFLRNIFVTSDIKIKEENLFCDNIKGNEIFPSQQ   1051 - 1120
IARLIECERVLVALELSNFLNDSSYALQAVTQCYGLLAPIIYHNIVLVPVVQILIKCIVVLQGLPSIVCS   1121 - 1190
KKHTASFESIQHMIACCIFYITKILRSWREYDLAVMIINYGKKMLDITPGCKSLFDGSNEQEEMPEEDSS   1191 - 1260
KKSLKTKKPQQILLPEKINEQLALLETHLLKLTKQYVTSELSGGEDPIFLYPVVLNWSVKGAVKEVMKFK   1261 - 1330
QKPRFLEFFTQVMLKCMNEEKFHLMVEVTTPVHDFLKRRNESLLGLIKVKYKDSALNKKANKSLKFKAAV   1331 - 1400
MEIGRSAEMQQRIRSKKKETLRDFIFKNPAISEMVAHERNRRTSVRKAAQRYLMDYLNPLILSYVKRKRF   1401 - 1470
HRLSLEEMPWRAQMNLYLAGAHFNLVLQKLWECTKMKFGTSHMMVSFRSCDPNMFSLYNSGTVLPTRKLT   1471 - 1540
VENYKAMLDFLLTAKKRKANLPSDAEEFSTFINSIMSDENMSKTQTVYDSDSQSGSSAKEKDRGANLCVM   1541 - 1610
DHFMKIFLYCRRAMVLAHRGGYWTLLQNCCRALWNFTQELQILLKQAVDLDKTFPISQDGFLCTSVLPFY   1611 - 1680
LGAELLIDMLIQLQNTSSIKPIEDKGEFSVPSCYGNIKNDNGGSSLTFEHPLDDVNVVDLKWIHDFVLKS   1681 - 1750
LEVLYQVEKWETLVSLAIQFNTVSHERYTEQVTPLLVYAQRQLLLRIQKFKGPDITQQPCARYEAEYGEK   1751 - 1820
ITCRNFIGKQLKINSSTIEATSNCTDLLKMLISSEYSRAKALVCVPVDVTDTLRCFRETLEKSKYHNRSI   1821 - 1890
RHSRKLLSLFLAQTQDVLQASNQRSLKVQALHSLGSLLIFAEKKRAAFKCWCQALDDIFRKPDVLHTWKE   1891 - 1960
FGPSLTNVTNSHSPPGFKDYSEEFLSRVGIWGCLQGAVISAKIAQFIKSLNVEKKTDCCILSALLFQGLL   1961 - 2030
RTTLPHPKAERCYAQYEITQLLPGIELFSDRYRADICSVIASLYYIIRELHFVRQNLIVLPLLALYQYFV   2031 - 2100
SGICQDITRNLEARILKIEVLIDLRFFSEAFYEISQIFYGKNMPCPIPAGYKATGKMKIFQSFDSGKLLT   2101 - 2170
SKENIQAIDELRNKGLPAVLVTIGQPHLLNKFNFVKAYFFLSVAATINCVPENKFKTVITNKSKPNLPNL   2171 - 2240
EEIYSKDDGSSFYNLTKLKDEITLSMLKSMLLMEAEDRLNFLLSEVEQKTLSQCSAGELEIVVEARLQLA   2241 - 2310
AVALQRHRAAYSAAIVFSTLTLLQDSKLFEKKVVQDDTENPVSPGTSVTENKDDSEFLDPISLNAREYFN   2311 - 2380
IHLWLRCRLALVTAFVAQIHGIGIVKEDDMTDCLSLINEVCMEAKSAGDTELQAEFLTQAVILGLQEKHL   2381 - 2450
KADIMTNLQDIIHLLEGNEFISPQSRLTLARSLVLLDDLTKAEKFKESPSSKTGKLNLLTRAHSILTEQM   2451 - 2520
LAFGETIEFRSSNTKYANPLQPLKNIYLPHVMLLAKIKMRIGHTVAKQVYYKNKRKDPSKWLPALHLFDV   2521 - 2590
ALKLCRTTAVEEHEVEAEILFQKGKIERQILMEEKSPSFQLESLYEAIQLSLKNDQNSGLIRDSYLEMAL   2591 - 2660
LYFHLKKPKIKISGSPLTLKPPLRRSSSVKETSANKFEMYSSLAWIAIRAAAQVSEAVLAINLLIGKKNT   2661 - 2730
RMHKVNQVALPNIPEFAALDLLSSYTDYLLDNYQVLFQTSCTFLYQNDDVCDSADGRKKTQTKVDITWIL   2731 - 2800
LLRYYIHLQRINNLSKLLASATPVSGISLPDDTLLTSLYNSELILRQKEVHFFLKKFLQLYSSSCIDEFP   2801 - 2870
KELLCQLENPPLSEKDLRESSAKLYRDSSVQSILSFKPVSGSSCVDITPIEMVTQASNKELCFQWYIPPL   2871 - 2940
DRPPKETEPMVLLLYAYNLKPLKISDVRHSTYNSTCVGSLWIPLNRVIAIHEKLSNLAQIAELSLPAAPE   2941 - 3010
ITSNENIYEVEVEEESVDNEMEDMIIQCCSEIASLFLNDKEPTPLSEVPFDISLPSIFNLERLFDLANGC   3011 - 3080
ILSGGSLFNWIVSIIP                                                         3081 - 3096
//

Text Mined References (7)

PMID Year Title
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.