Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.27
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 4.1e-05
group 3 medulloblastoma 4104 9.6e-04
Disease Target Count Z-score Confidence
Cataract 8 multiple types 33 4.115 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.100 9.6e-04
osteosarcoma -1.435 4.1e-05

Gene RIF (1)

AA Sequence

MAAAPPLRDRLSFLHRLPILLKGTSDDDVPCPGYLFEEIAKISHESPGSSQCLLEYLLSRLHSSSGHGKL      1 - 70
KVLKILLYLCSHGSSFFLLILKRNSAFIQEAAAFAGPPDPLHGNSLYQKVRAAAQDLGSTLFSDTVLPLA     71 - 140
PSQPLGTPPATGMGSQARPHSTLQGFGYSKEHGRTAVRHQPGQAGGGWDELDSGPSSQNSSQNSDLSRVS    141 - 210
DSGSHSGSDSHSGASREPGDLAERVEVVALSDCQQELSLVRTVTRGPRAFLSREEAQHFIKACGLLNCEA    211 - 280
VLQLLTCHLRGTSECTQLRALCAIASLGSSDLLPQEHILLRTRPWLQELSMGSPGPVTNKATKILRHFEA    281 - 350
SCGQLSPARGTSAEPGPTAALPGPSDLLTDAVPLPGSQVFLQPLSSTPVSSRSPAPSSGMPSSPVPTPPP    351 - 420
DASPIPAPGDPSEAEARLAESRRWRPERIPGGTDSPKRGPSSCAWSRDSLFAGMELVACPRLVGAGAAAG    421 - 490
ESCPDAPRAPQTSSQRTAAKEPPGSEPSAFAFLNA                                       491 - 525
//

Text Mined References (12)

PMID Year Title