Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 3.0
Disease Target Count Z-score Confidence
Infertility 188 3.281 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.400 4.1e-06
medulloblastoma, large-cell -1.300 2.2e-04
non primary Sjogren syndrome sicca 1.200 2.0e-02
osteosarcoma -1.637 1.4e-05
progressive supranuclear palsy 1.100 1.2e-02

Synonym

Accession Q96N06 A8WFL2 B4DZN8
Symbols C16orf55

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

AA Sequence

MVTHAAGARTFCEEQKKGSTYSVPKSKEKLMEKHSQEARQADRESEKPVDSLHPGAGTAKHPPPAASLEE      1 - 70
KPDVKQKSSRKKVVVPQIIITRASNETLVSCSSSGSDQQRTIREPEDWGPYRRHRNPSTADAYNSHLKE      71 - 139
//

Text Mined References (8)

PMID Year Title