Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.62910208495643E-9
osteosarcoma 7933 1.37748586919154E-5
medulloblastoma, large-cell 6234 2.180631136219E-4
progressive supranuclear palsy 674 0.0121785769224023
non primary Sjogren syndrome sicca 840 0.0196816578522157
Disease Target Count Z-score Confidence
Melanoma 261 0.0 2.0
Disease Target Count Z-score Confidence
Infertility 163 3.296 1.6

Expression

  Differential Expression (5)

Synonym

Accession Q96N06 A8WFL2 B4DZN8
Symbols C16orf55

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG

AA Sequence

MVTHAAGARTFCEEQKKGSTYSVPKSKEKLMEKHSQEARQADRESEKPVDSLHPGAGTAKHPPPAASLEE      1 - 70
KPDVKQKSSRKKVVVPQIIITRASNETLVSCSSSGSDQQRTIREPEDWGPYRRHRNPSTADAYNSHLKE      71 - 139
//

Text Mined References (8)

PMID Year Title
23844118 2013 A novel testis-enriched gene Spata33 is expressed during spermatogenesis.
23456168 2013 Genome-wide association study in Han Chinese identifies three novel loci for human height.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.