Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.14
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -1.700 0.000
ependymoma -1.500 0.000
glioblastoma -2.500 0.000
oligodendroglioma -1.900 0.000
osteosarcoma 1.083 0.000
medulloblastoma -2.700 0.000
medulloblastoma, large-cell -2.100 0.002
adult high grade glioma -2.400 0.000
atypical teratoid/rhabdoid tumor -1.500 0.006
pilocytic astrocytoma -2.300 0.000
lung adenocarcinoma 1.400 0.004
pituitary cancer 1.400 0.000
psoriasis -1.300 0.000

Gene RIF (1)

PMID Text
21393573 VSTM2L is the first example of a secreted antagonist of humanin (HN) and may play a role in the modulation of HN biological function.

AA Sequence

MGAPLAVALGALHYLALFLQLGGATRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSP      1 - 70
SYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGTY     71 - 140
ECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL          141 - 204
//

Text Mined References (8)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
21393573 2011 VSTM2L is a novel secreted antagonist of the neuroprotective peptide Humanin.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.