Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 4.1e-20

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 4.1e-20

AA Sequence

MEGCAVRRGSCPLLPGPSAWRASPAGWAGRAKLRSWCRASGLPNRPYTLTGGRHGSVSLLRHPGTTTFVQ      1 - 70
QRSLHQSWEKRIVFSACPVSRSWCPERNFSGSIPAVTPPKLPGHSKSEGPPGKVRKRTTIRSQPLFVTRT     71 - 140
RGFGSAVGWLPLGSPVL                                                         141 - 157
//

Text Mined References (6)

PMID Year Title