Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.67
PubTator Score 0.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -2.100 0.000
glioblastoma -1.900 0.002
astrocytoma -1.300 0.033
atypical teratoid / rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -1.200 0.009
adult high grade glioma -2.000 0.000
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.291 0.041

AA Sequence

MATPNNLTPTNCSWWPISALESDAAKPAEAPDAPEAASPAHWPRESLVLYHWTQSFSSQKVRLVIAEKGL      1 - 70
VCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPEVGSLQHA     71 - 140
RVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANATTDLMKLDHEEEPQLSEPYLSK    141 - 210
QKKLMAKILEHDDVSYLKKILGELAMVLDQIEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRL    211 - 280
KFLGLSKKYWEDGSRPNLQSFFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGS    281 - 350
LGGMGYFAYWYLKKKYI                                                         351 - 367
//

Text Mined References (11)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11125086 2001 HUNT: launch of a full-length cDNA database from the Helix Research Institute.
More...