Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.68
PubTator Score 0.96

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -2.000 9.8e-05
astrocytoma -1.300 3.3e-02
Astrocytoma, Pilocytic -1.200 2.1e-04
atypical teratoid / rhabdoid tumor -2.800 1.4e-07
ependymoma -2.100 4.8e-14
glioblastoma -1.200 2.9e-03
medulloblastoma, large-cell -1.200 8.8e-03
subependymal giant cell astrocytoma -1.291 4.1e-02

Synonym

Accession Q96MZ0 B7Z621 Q5TE60 Q68CW7 Q9BQJ7 Q9BQV4 Q9BWJ4 Q9H3Y2 Q9H4G5 GDAP1-L1
Symbols dJ881L22.1
dJ995J12.1.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MATPNNLTPTNCSWWPISALESDAAKPAEAPDAPEAASPAHWPRESLVLYHWTQSFSSQKVRLVIAEKGL      1 - 70
VCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPEVGSLQHA     71 - 140
RVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANATTDLMKLDHEEEPQLSEPYLSK    141 - 210
QKKLMAKILEHDDVSYLKKILGELAMVLDQIEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRL    211 - 280
KFLGLSKKYWEDGSRPNLQSFFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGS    281 - 350
LGGMGYFAYWYLKKKYI                                                         351 - 367
//

Text Mined References (11)

PMID Year Title