Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.39
PubTator Score 2.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MSDSTWMSADPHLASSLSPSQDERMRSPQNLHSQEDDDSSSESGSGNGSSTLNPSTSSSTQGDPAFPEMN      1 - 70
GNGAVAPMDFTTAAEDQPINLCDKLPPATALGTASYPSDGCGADGLRSRVKYGVKTTPESPPYSSGSYDS     71 - 140
IKTEVSGCPEDLTVGRAPTADDDDDDHDDHEDNDKMNDSEGMDPERLKAFNMFVRLFVDENLDRMVPISK    141 - 210
QPKEKIQAIIESCSRQFPEFQERARKRIRTYLKSCRRMKKNGMEMTRPTPPHLTSAMAENILAAACESET    211 - 280
RKAAKRMRLEIYQSSQDEPIALDKQHSRDSAAITHSTYSLPASSYSQDPVYANGGLNYSYRGYGALSSNL    281 - 350
QPPASLQTGNHSNGPTDLSMKGGASTTSTTPTPTPSSTSTSRPVPTAQLSPTEISAVRQLIAGYRESAAF    351 - 420
LLRSADELENLILQQN                                                          421 - 436
//

Text Mined References (13)

PMID Year Title