Property Summary

NCBI Gene PubMed Count 15
PubMed Score 36.51
PubTator Score 4.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MSAFEKPQIIAHIQKGFNYTVFDCKWVPCSAKFVTMGNFARGTGVIQLYEIQHGDLKLLREIEKAKPIKC      1 - 70
GTFGATSLQQRYLATGDFGGNLHIWNLEAPEMPVYSVKGHKEIINAIDGIGGLGIGEGAPEIVTGSRDGT     71 - 140
VKVWDPRQKDDPVANMEPVQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMALRWETNIKN    141 - 210
GVCSLEFDRKDISMNKLVATSLEGKFHVFDMRTQHPTKGFASVSEKAHKSTVWQVRHLPQNRELFLTAGG    211 - 280
AGGLHLWKYEYPIQRSKKDSEGIEMGVAGSVSLLQNVTLSTQPISSLDWSPDKRGLCVCSSFDQTVRVLI    281 - 350
VTKLNKI                                                                   351 - 357
//

Text Mined References (19)

PMID Year Title