Property Summary

NCBI Gene PubMed Count 12
PubMed Score 34.65
PubTator Score 4.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
23844004 Exosome-bound WD repeat protein Monad inhibits breast cancer cell invasion by degrading amphiregulin mRNA.
19450687 Is part of an RNA polymerase II-associated complex with possible chaperone activity.
16487927 Monad may function as a novel modulator of apoptosis pathway.
16487927 Monad could be involved in apoptosis induced by TNF-alpha

AA Sequence

MSAFEKPQIIAHIQKGFNYTVFDCKWVPCSAKFVTMGNFARGTGVIQLYEIQHGDLKLLREIEKAKPIKC      1 - 70
GTFGATSLQQRYLATGDFGGNLHIWNLEAPEMPVYSVKGHKEIINAIDGIGGLGIGEGAPEIVTGSRDGT     71 - 140
VKVWDPRQKDDPVANMEPVQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMALRWETNIKN    141 - 210
GVCSLEFDRKDISMNKLVATSLEGKFHVFDMRTQHPTKGFASVSEKAHKSTVWQVRHLPQNRELFLTAGG    211 - 280
AGGLHLWKYEYPIQRSKKDSEGIEMGVAGSVSLLQNVTLSTQPISSLDWSPDKRGLCVCSSFDQTVRVLI    281 - 350
VTKLNKI                                                                   351 - 357
//

Text Mined References (16)

PMID Year Title
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23844004 2013 Exosome-bound WD repeat protein Monad inhibits breast cancer cell invasion by degrading amphiregulin mRNA.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21468892 2011 Structure and function of WD40 domain proteins.
21269460 2011 Initial characterization of the human central proteome.
21078300 2010 PIH1D1, a subunit of R2TP complex, inhibits doxorubicin-induced apoptosis.
19450687 2009 High-resolution mapping of the protein interaction network for the human transcription machinery and affinity purification of RNA polymerase II-associated complexes.
18538670 2008 Molecular cloning of novel Monad binding protein containing tetratricopeptide repeat domains.
16600877 2006 Structural basis for the specific recognition of methylated histone H3 lysine 4 by the WD-40 protein WDR5.
More...