Property Summary

NCBI Gene PubMed Count 14
PubMed Score 13.71
PubTator Score 11.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
25990505 Reduced expression of CMTM3 is associated with prostate cancer.
25946973 Low expression of CMTM3 was associated with metastasis and recurrence of oral squamous cell carcinoma.
25931111 CMTM1 and 3 are priority targets in glioblastomas. First insights into signalling of these two genes that might be conveyed by growth factor receptor, Src family kinase and WNT activation was presented.
24131472 Peritoneal disseminated metastases were significantly suppressed by CMTM3.
23907292 CMTM3 is significantly down-regulated in clear cell renal cell carcinoma and exerts remarkable tumor-suppressive functions
18402773 CMTM3 inhibits prostate-specific antigen expression at both mRNA and protein levels with no obvious influence on androgen receptor expression.
17002874 CMTM3/CKLFSF3 is an evolutionarily conserved gene that may have important roles in the male reproductive system and immune system.
12782130 Bioinformatics based on CKLF2 cDNA and protein sequences in combination with experimental validation identified CKLFSF1-8 gene clusters, between the SCY and the TM4SF gene families. The 8 family members were cloned and characterized.

AA Sequence

MWPPDPDPDPDPEPAGGSRPGPAVPGLRALLPARAFLCSLKGRLLLAESGLSFITFICYVASSASAFLTA      1 - 70
PLLEFLLALYFLFADAMQLNDKWQGLCWPMMDFLRCVTAALIYFAISITAIAKYSDGASKAAGVFGFFAT     71 - 140
IVFATDFYLIFNDVAKFLKQGDSADETTAHKTEEENSDSDSD                                141 - 182
//

Text Mined References (15)

PMID Year Title
25990505 2015 CMTM3 is reduced in prostate cancer and inhibits migration, invasion and growth of LNCaP cells.
25946973 2015 CMTM3 inhibits cell growth and migration and predicts favorable survival in oral squamous cell carcinoma.
25931111 2015 Systematic investigation of CMTM family genes suggests relevance to glioblastoma pathogenesis and CMTM1 and CMTM3 as priority targets.
25416956 2014 A proteome-scale map of the human interactome network.
24131472 2014 CMTM3 inhibits cell migration and invasion and correlates with favorable prognosis in gastric cancer.
23907292 2014 CMTM3 is frequently reduced in clear cell renal cell carcinoma and exhibits tumor suppressor activities.
19509237 2009 CMTM3, located at the critical tumor suppressor locus 16q22.1, is silenced by CpG methylation in carcinomas and inhibits tumor cell growth through inducing apoptosis.
18402773 2008 CMTM3 can affect the transcription activity of androgen receptor and inhibit the expression level of PSA in LNCaP cells.
17002874 2006 Characterization and expression profile of CMTM3/CKLFSF3.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
More...