Property Summary

NCBI Gene PubMed Count 21
PubMed Score 16.93
PubTator Score 11.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (15)

AA Sequence

MWPPDPDPDPDPEPAGGSRPGPAVPGLRALLPARAFLCSLKGRLLLAESGLSFITFICYVASSASAFLTA      1 - 70
PLLEFLLALYFLFADAMQLNDKWQGLCWPMMDFLRCVTAALIYFAISITAIAKYSDGASKAAGVFGFFAT     71 - 140
IVFATDFYLIFNDVAKFLKQGDSADETTAHKTEEENSDSDSD                                141 - 182
//

Text Mined References (22)

PMID Year Title