Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MASKCSSERKSRTSLTLNQKLEMIKLSEEGMSKAEIGRRLGLLRQTVSQVVNAKEKFLKEVKSATPMNTR      1 - 70
MIRKRNSLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFNSMKAERGVEAAEEKFEASRGWFMRFK     71 - 140
ERSHFHNIKAQGEAASADVEAAASYPEALAKIIDEGGYTKQQIFNVDETAFYWKKMPSRTFIAREEKSVP    141 - 210
GFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRALKNYTKSTLPVLYKWNSKARMTAHLFTAWFTEYF    211 - 280
KPTVETYCSEKKIPFKILLLIDNAPSHPRALMEIYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNT    281 - 350
FHKALAAMDSDVSDGSGQSKLKTFWKGFTILDAIKNIRDSWEEVKLSTLTGVWKKLIPTLIDDYEGFKTS    351 - 420
VEEVSADVVEIAKELELEVEPEDVTELLQSHDKTLTDEELFLMDAQRKWFLEMESTPGEDAVNIVEMTTK    421 - 490
DLEYYINLVDKAAAGFERIDSNFERSSTVGKMLSNSIACYREIFHERKSQLMRKASPMSYFRKLPQPPQP    491 - 560
SAATTLTSQQPSTSRQDPPPAKRVRLTEGSD                                           561 - 591
//

Text Mined References (7)

PMID Year Title
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8917322 1996 Members of the pogo superfamily of DNA-mediated transposons in the human genome.
8643651 1996 Tiggers and DNA transposon fossils in the human genome.