Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.71
PubTator Score 4.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 8.90351892091276E-14
lung adenocarcinoma 2714 2.63068009723907E-12
posterior fossa group A ependymoma 1511 1.4088378478063E-10
glioblastoma 5572 3.37872508896511E-9
pilocytic astrocytoma 3086 3.00954367975052E-8
pediatric high grade glioma 2712 4.32756569414542E-7
sonic hedgehog group medulloblastoma 1482 5.25268802915032E-7
Breast cancer 3099 1.74219167003102E-6
atypical teratoid/rhabdoid tumor 1095 8.74756193749109E-6
primitive neuroectodermal tumor 3031 2.60634455130509E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.33954288356809E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 1.5170313796188E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00277954318240984
Disease Target Count Z-score Confidence
Intellectual disability 573 3.306 1.7
Disease Target Count Z-score Confidence
Polyhydramnios 29 3.24 1.6
Disease Target Count
Mental retardation, X-linked 91 1

Expression

Synonym

Accession Q96MV8 B3KVG7 Q3SY30 Q6UWH3
Symbols MRX91

Gene

  Ortholog (15)

Pathway (1)

AA Sequence

MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTW      1 - 70
TYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPD     71 - 140
RCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSK    141 - 210
FHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKF    211 - 280
WLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET                 281 - 337
//

Text Mined References (10)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15915161 2005 Loss of ZDHHC15 expression in a woman with a balanced translocation t(X;15)(q13.3;cen) and severe mental retardation.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.