Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.54
PubTator Score 0.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
urothelial carcinoma -1.900 0.019
astrocytic glioma -2.100 0.037
ependymoma -2.600 0.015
oligodendroglioma -2.600 0.020
glioblastoma -3.900 0.000
osteosarcoma -5.291 0.000
medulloblastoma -4.200 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -5.300 0.000
primitive neuroectodermal tumor -3.400 0.000
Amyotrophic Lateral Sclerosis 1.282 0.000
Atopic dermatitis -1.600 0.038
pancreatic ductal adenocarcinoma liver m... -2.819 0.003
interstitial cystitis -1.500 0.001
cystic fibrosis -1.700 0.000
pediatric high grade glioma -3.300 0.000
pilocytic astrocytoma -1.500 0.006
aldosterone-producing adenoma -1.215 0.020
psoriasis -2.300 0.000
Pneumonia 1.100 0.019
subependymal giant cell astrocytoma -2.810 0.003
ductal carcinoma in situ -1.500 0.049
invasive ductal carcinoma -1.800 0.018
ulcerative colitis -2.300 0.000
ovarian cancer -1.100 0.006

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEINTKLLISVTCISFFTFQLLFYFVSYWFSAKVSPGFNSLSFKKKIEWNSRVVSTCHSLVVGIFGLYIF      1 - 70
LFDEATKADPLWGGPSLANVNIAIASGYLISDLSIIILYWKVIGDKFFIMHHCASLYAYYLVLKNGVLAY     71 - 140
IGNFRLLAELSSPFVNQRWFFEALKYPKFSKAIVINGILMTVVFFIVRIASMLPHYGFMYSVYGTEPYIR    141 - 210
LGVLIQLSWVISCVVLDVMNVMWMIKISKGCIKVISHIRQEKAKNSLQNGKLD                     211 - 263
//

Text Mined References (7)

PMID Year Title
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.