Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.54
PubTator Score 0.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.97652183413536E-34
medulloblastoma 1524 2.09041513520926E-9
osteosarcoma 7933 1.01882757985099E-8
atypical teratoid / rhabdoid tumor 4369 5.08103226747316E-8
Amyotrophic Lateral Sclerosis 432 3.96268137730544E-7
medulloblastoma, large-cell 6234 1.06153549241152E-6
ulcerative colitis 2087 1.08823776523489E-6
pediatric high grade glioma 2712 9.58242489073703E-6
glioblastoma 5572 1.01348562369916E-5
cystic fibrosis 1670 1.29995088534095E-4
primitive neuroectodermal tumor 3031 1.45213907381449E-4
interstitial cystitis 2299 0.00133525750917775
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00297788559041645
subependymal giant cell astrocytoma 2287 0.00338912131611827
ovarian cancer 8492 0.00569977772662634
pilocytic astrocytoma 3086 0.00575947228122332
ependymoma 2514 0.0153703336594897
invasive ductal carcinoma 2950 0.0180383878684506
urothelial carcinoma 318 0.0189779530899766
Pneumonia 133 0.0193337267465454
oligodendroglioma 2849 0.0197010369872284
aldosterone-producing adenoma 664 0.0201587287676234
astrocytic glioma 2241 0.0368923156266121
Atopic dermatitis 944 0.0379015866993426
ductal carcinoma in situ 1745 0.0485912372875854

Expression

  Differential Expression (25)

Disease log2 FC p
urothelial carcinoma -1.900 0.019
astrocytic glioma -2.100 0.037
ependymoma -2.600 0.015
oligodendroglioma -2.600 0.020
glioblastoma -3.900 0.000
osteosarcoma -5.291 0.000
medulloblastoma -4.200 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -5.300 0.000
primitive neuroectodermal tumor -3.400 0.000
Amyotrophic Lateral Sclerosis 1.282 0.000
Atopic dermatitis -1.600 0.038
pancreatic ductal adenocarcinoma liver m... -2.819 0.003
interstitial cystitis -1.500 0.001
cystic fibrosis -1.700 0.000
pediatric high grade glioma -3.300 0.000
pilocytic astrocytoma -1.500 0.006
aldosterone-producing adenoma -1.215 0.020
psoriasis -2.300 0.000
Pneumonia 1.100 0.019
subependymal giant cell astrocytoma -2.810 0.003
ductal carcinoma in situ -1.500 0.049
invasive ductal carcinoma -1.800 0.018
ulcerative colitis -2.300 0.000
ovarian cancer -1.100 0.006

Synonym

Accession Q96MV1 B2RPI2 D3DT48
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEINTKLLISVTCISFFTFQLLFYFVSYWFSAKVSPGFNSLSFKKKIEWNSRVVSTCHSLVVGIFGLYIF      1 - 70
LFDEATKADPLWGGPSLANVNIAIASGYLISDLSIIILYWKVIGDKFFIMHHCASLYAYYLVLKNGVLAY     71 - 140
IGNFRLLAELSSPFVNQRWFFEALKYPKFSKAIVINGILMTVVFFIVRIASMLPHYGFMYSVYGTEPYIR    141 - 210
LGVLIQLSWVISCVVLDVMNVMWMIKISKGCIKVISHIRQEKAKNSLQNGKLD                     211 - 263
//

Text Mined References (7)

PMID Year Title
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.