Property Summary

NCBI Gene PubMed Count 22
PubMed Score 14.54
PubTator Score 14.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma -1.106 4.0e-03
axial spondyloarthropathy 1.200 1.5e-02
ependymoma 1.200 7.4e-06
medulloblastoma, large-cell 1.200 1.0e-02
mucosa-associated lymphoid tissue lympho... 1.839 1.2e-02
non-small cell lung cancer 1.564 4.0e-11
osteosarcoma 1.184 6.1e-03
ovarian cancer -1.200 3.4e-05
primary pancreatic ductal adenocarcinoma -1.036 4.9e-03
psoriasis 1.100 9.6e-05
Rheumatoid arthritis 1.300 2.8e-02
spina bifida -1.372 4.1e-02

 GWAS Trait (1)

Gene RIF (13)

AA Sequence

MAPPAARLALLSAAALTLAARPAPSPGLGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLK      1 - 70
YPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSN     71 - 140
KLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTL    141 - 210
VGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLA    211 - 280
RFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSA    281 - 350
ARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVEGWTVYGLATLLILTVTAIVAKILLHVTFKSH    351 - 420
RVPASGDLRDCHQPGTSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNPLVSD                     421 - 473
//

Text Mined References (22)

PMID Year Title