Property Summary

NCBI Gene PubMed Count 20
Grant Count 15
R01 Count 10
Funding $1,825,093.43
PubMed Score 14.34
PubTator Score 14.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.028
osteosarcoma -1.384 0.011
ependymoma 1.200 0.000
medulloblastoma, large-cell 1.200 0.010
adrenocortical carcinoma -1.106 0.004
primary pancreatic ductal adenocarcinoma -1.036 0.005
non-small cell lung cancer 1.564 0.000
psoriasis 1.900 0.000
spina bifida -1.372 0.041
mucosa-associated lymphoid tissue lympho... 1.839 0.012
ovarian cancer 1.400 0.003
axial spondyloarthropathy 1.200 0.015

Gene RIF (11)

PMID Text
26206087 Kremen1 has a pro-apoptotic activity that is decreased upon Dkk1 binding or by cancer mutations.
23041840 Six Dkk-1, three Sost, one Kremen-1 and 10 LRP-5 polymorphisms were significantly associated with radiological progression of rheumatoid arthritis joint destruction.
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20846389 The mRNA expression levels of DKK-1 binding receptor LRP5/6 and Krm1/2 in SCs from patients with MM were significantly higher than those in myeloma cells and in SCs from healthy donors.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20153141 This study demonstrated that a representative tSNP of KREMEN1 might modulate the risk of schizophrenia in the Japanese population.
20153141 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
18502762 Kremen may not be essential for Dkk1-mediated Wnt antagonism and Kremen may only play a role when cells express a high level of LRP5/6
More...

AA Sequence

MAPPAARLALLSAAALTLAARPAPSPGLGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLK      1 - 70
YPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSN     71 - 140
KLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTL    141 - 210
VGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLA    211 - 280
RFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSA    281 - 350
ARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVEGWTVYGLATLLILTVTAIVAKILLHVTFKSH    351 - 420
RVPASGDLRDCHQPGTSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNPLVSD                     421 - 473
//

Text Mined References (20)

PMID Year Title
26206087 2016 Kremen1 and Dickkopf1 control cell survival in a Wnt-independent manner.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
23041840 2013 Genetic studies on components of the Wnt signalling pathway and the severity of joint destruction in rheumatoid arthritis.
20935629 2010 Meta-analysis identifies 13 new loci associated with waist-hip ratio and reveals sexual dimorphism in the genetic basis of fat distribution.
20846389 2010 Differential expression of DKK-1 binding receptors on stromal cells and myeloma cells results in their distinct response to secreted DKK-1 in myeloma.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20153141 2010 Genetic association study of KREMEN1 and DKK1 and schizophrenia in a Japanese population.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
18538647 2008 Genetic analysis and effect of triiodothyronine and prednisone trial on bone turnover in a patient with craniotubular hyperostosis.
More...