Property Summary

NCBI Gene PubMed Count 30
PubMed Score 22.47
PubTator Score 15.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.072 9.5e-05
Amyotrophic lateral sclerosis 1.024 3.5e-06
Breast cancer -1.100 5.1e-12
dermatomyositis 1.100 2.9e-04
juvenile dermatomyositis 1.010 6.7e-10
Multiple myeloma 1.508 2.2e-03
osteosarcoma -2.006 8.6e-07
ovarian cancer -1.700 1.7e-07
spina bifida -1.251 4.4e-02
tuberculosis and treatment for 6 months 1.200 8.1e-03

Gene RIF (8)

AA Sequence

MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSDRMESTDTKRQKPSVHSRQLV      1 - 70
SKPLSSSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKRDP     71 - 140
ERRAKSPTPDGSERIGLEVDRRASRSSQSSKEEVNSEEYGSDHETGSSGSSDEQGNNTENEEEGVEEDVE    141 - 210
EDEEVEEDAEEDEEVDEDGEEEEEEEEEEEEEEEEEEEEYEQDERDQKEEGNDYDTRSEASDSGSESVSF    211 - 280
TDGSVRSGSGTDGSDEKKKERKRARGISPIVFDRSGSSASESYAGSEKKHEKLSSSVRAVRKDQTSKLKY    281 - 350
VLQDARFFLIKSNNHENVSLAKAKGVWSTLPVNEKKLNLAFRSARSVILIFSVRESGKFQGFARLSSESH    351 - 420
HGGSPIHWVLPAGMSAKMLGGVFKIDWICRRELPFTKSAHLTNPWNEHKPVKIGRDGQEIELECGTQLCL    421 - 490
LFPPDESIDLYQVIHKMRHKRRMHSQPRSRGRPSRREPVRDVGRRRPEDYDIHNSRKKPRIDYPPEFHQR    491 - 560
PGYLKDPRYQEVDRRFSGVRRDVFLNGSYNDYVREFHNMGPPPPWQGMPPYPGMEQPPHHPYYQHHAPPP    561 - 630
QAHPPYSGHHPVPHEARYRDKRVHDYDMRVDDFLRRTQAVVSGRRSRPRERDRERERDRPRDNRRDRERD    631 - 700
RGRDRERERERLCDRDRDRGERGRYRR                                               701 - 727
//

Text Mined References (39)

PMID Year Title