Property Summary

NCBI Gene PubMed Count 29
PubMed Score 16.96
PubTator Score 15.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.508 0.002
osteosarcoma -2.006 0.000
juvenile dermatomyositis 1.010 0.000
Amyotrophic Lateral Sclerosis 1.024 0.000
acute quadriplegic myopathy 1.072 0.000
tuberculosis and treatment for 6 months 1.200 0.008
spina bifida -1.251 0.044
Breast cancer -1.100 0.000
ovarian cancer -1.700 0.000
dermatomyositis 1.100 0.000

Synonym

Accession Q96MU7 Q4W5Q3 Q7Z622 Q8TF35
Symbols YT521
YT521-B

Gene

PDB

2YUD   4R3H   4R3I  

Gene RIF (7)

PMID Text
26876937 Results show that YTHDC1 promotes exon inclusion in targeted mRNAs through recruiting pre-mRNA splicing factor SRSF3 while blocking SRSF10 mRNA binding.
25242552 The YTHDC1-binding sites and biochemical experiments, not only reveal the specific mode of m(6)A-YTH binding but also explain the preferential recognition of the GG(m(6)A)C sequences by YTHDC1.
23865345 Studied mRNA levels of FOXO1, KLF9 and YT521 in human normal and cancerous endometrial tissue. A remarkable (not significant, p = 0.069) increase was found in the YT521 mRNA level of patients' endometrial tissue in comparison with the control subjects.
23765422 Hypoxia induces a specific switch in YT521 expression pattern towards the two non-protein coding mRNA variants, the already characterized isoform 3 and the newly discovered exon 8-skipping isoform.
20686370 Lack of YT521 protein is associated with endometrial cancer.
15175272 phosphorylation causes sequestration of YT521-B in an insoluble nuclear form, which is unable to change splice sites
12755701 YT521-B has a role in a gene expression in the pathogenesis of Emery-Dreifuss muscular dystrophy

AA Sequence

MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSDRMESTDTKRQKPSVHSRQLV      1 - 70
SKPLSSSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKRDP     71 - 140
ERRAKSPTPDGSERIGLEVDRRASRSSQSSKEEVNSEEYGSDHETGSSGSSDEQGNNTENEEEGVEEDVE    141 - 210
EDEEVEEDAEEDEEVDEDGEEEEEEEEEEEEEEEEEEEEYEQDERDQKEEGNDYDTRSEASDSGSESVSF    211 - 280
TDGSVRSGSGTDGSDEKKKERKRARGISPIVFDRSGSSASESYAGSEKKHEKLSSSVRAVRKDQTSKLKY    281 - 350
VLQDARFFLIKSNNHENVSLAKAKGVWSTLPVNEKKLNLAFRSARSVILIFSVRESGKFQGFARLSSESH    351 - 420
HGGSPIHWVLPAGMSAKMLGGVFKIDWICRRELPFTKSAHLTNPWNEHKPVKIGRDGQEIELECGTQLCL    421 - 490
LFPPDESIDLYQVIHKMRHKRRMHSQPRSRGRPSRREPVRDVGRRRPEDYDIHNSRKKPRIDYPPEFHQR    491 - 560
PGYLKDPRYQEVDRRFSGVRRDVFLNGSYNDYVREFHNMGPPPPWQGMPPYPGMEQPPHHPYYQHHAPPP    561 - 630
QAHPPYSGHHPVPHEARYRDKRVHDYDMRVDDFLRRTQAVVSGRRSRPRERDRERERDRPRDNRRDRERD    631 - 700
RGRDRERERERLCDRDRDRGERGRYRR                                               701 - 727
//

Text Mined References (37)

PMID Year Title
26876937 2016 Nuclear m(6)A Reader YTHDC1 Regulates mRNA Splicing.
26318451 2015 Structural Basis for the Discriminative Recognition of N6-Methyladenosine RNA by the Human YT521-B Homology Domain Family of Proteins.
25416956 2014 A proteome-scale map of the human interactome network.
25242552 2014 Structural basis for selective binding of m6A RNA by the YTHDC1 YTH domain.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23865345 2013 The evaluation of the FOXO1, KLF9 and YT521 genes expression in human endometrial cancer.
23765422 2014 Hypoxia-dependent mRNA expression pattern of splicing factor YT521 and its impact on oncological important target gene expression.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
More...