Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.04
PubTator Score 2.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
KBG syndrome 9 5.555 2.8
Astigmatism 54 3.024 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 9.3e-07
group 4 medulloblastoma 1.500 1.3e-04
medulloblastoma, large-cell 1.600 6.2e-06
osteosarcoma -1.179 4.6e-04
ovarian cancer 1.400 1.8e-14
psoriasis -1.400 5.4e-04

Gene RIF (1)

AA Sequence

MAAPDLAHGGHVSRDSVCLHEEQTQAAGMVAGWLINCYQDAVTFDDVAVDFTQEEWTLLDPSQRDLYRDV      1 - 70
MLENYENLASVEWRLKTKGPALRQDRSWFRASNETQTARSHNGGQLCDRTQCGEAFSEHSGLSTHVRTQN     71 - 140
TGDSCVSNHYERDFFIPCQKTLFKIGEQFSVLGQCGKAFSSTPNVVSQQACTRDRSLDYSSCGEVFLNQS    141 - 210
YLQARAGSHNGEETWKWKPCGKALTHSMGCATPVEMHAVRNPHVCRECGKAFRYTAYLTGRVQVHPGEKP    211 - 280
CELEECGKASPVSSSLTQHVRIHAAEKPCECKECGKAFTGLSGLSKHVQTDPGQKPYECKDCGKACGGFY    281 - 350
LLNEHGKTHTREKPFACVVCGKYFRNSSCLNNHVRIHTGIKPYTCSYCGKAFTVRCGLTRHVRTHTGEKP    351 - 420
YTCKDCGKAFCTSSGLTEHVRTHTGEKPYECKDCGKSFTVSSSLTEHARIHTGEKPYECKQCGKAFTGRS    421 - 490
GLTKHMRTHTGEKPYECKDCGKAYNRVYLLNEHVKTHTEEKPFICTVCRKSFRNSSCLNKHIQIHTGIKP    491 - 560
YECKDCGKTFTVSSSLTEHIRTHTGEKPYECKVCGKAFTTSSHLIVHIRTHTGEKPYICKECGKAFASSS    561 - 630
HLIEHRRTHTGEKPYICNECGKAFRASSHLHKHGRIHTGQKPYKCKECGKAYNRFYLLKEHLKTYTEEQV    631 - 700
FVCKDCGKSFKNSSCLNHHTQIHTDEKPF                                             701 - 729
//

Text Mined References (9)

PMID Year Title