Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non primary Sjogren syndrome sicca 891 1.6e-02

AA Sequence

MDELALSFSLTCLLPENRASLSPSQPLSFQCLKAPATLTWEDEKQQRWGQPHGPVSSPLLGDHRCLVPFR      1 - 70
DLNPSSEVNTANLLESPSSLLLTSCYICSYFSFYILGEKRCHSLKRLRYSVCCKVCPNFCACGKENVSGT     71 - 140
GQVCTGVHVGAKEQEEPGGTQALRSCGIYCLEERTDKASHEECRERSTLGRPQCTGLTPSLAGESPCPRL    141 - 210
LPGSPTVRHLIASSCPGLSDPLPLPPGTLPLGS                                         211 - 243
//

Text Mined References (2)

PMID Year Title