Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non primary Sjogren syndrome sicca 840 0.0155560745775154

AA Sequence

MDELALSFSLTCLLPENRASLSPSQPLSFQCLKAPATLTWEDEKQQRWGQPHGPVSSPLLGDHRCLVPFR      1 - 70
DLNPSSEVNTANLLESPSSLLLTSCYICSYFSFYILGEKRCHSLKRLRYSVCCKVCPNFCACGKENVSGT     71 - 140
GQVCTGVHVGAKEQEEPGGTQALRSCGIYCLEERTDKASHEECRERSTLGRPQCTGLTPSLAGESPCPRL    141 - 210
LPGSPTVRHLIASSCPGLSDPLPLPPGTLPLGS                                         211 - 243
//

Text Mined References (2)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.