Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.28
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
chronic rhinosinusitis -1.880 1.3e-02
cystic fibrosis and chronic rhinosinusit... -1.478 3.0e-02
ependymoma 2.000 2.9e-02
group 3 medulloblastoma 1.200 2.5e-03
intraductal papillary-mucinous adenoma (... 1.700 9.8e-04
intraductal papillary-mucinous carcinoma... 1.300 2.9e-03
lung cancer 1.700 6.9e-03
psoriasis -1.100 2.4e-02
tuberculosis 1.200 5.2e-06

Gene RIF (2)

AA Sequence

MKEPDDQDTDGEKSVTSKSDGKKSLRSSKSESRSPVQEDNTFLEDDTDETFTKGEGSYLEEDSDEERLEG      1 - 70
SLSSFQYGDLQSTTVPQQTPAPAVEEAEEEVKKKISESFFYDYMELASMPFVTLDSNIPLDLLTLVHSFG     71 - 140
YDCRKRANLQLLDDSIAIYIAGNQLIFLNLKTKEQIYLRSSSGEGIGVIGVHPHKTYFTVAEKGSFPDII    141 - 210
IYEYPSLRPYRVLRDGTEKGYAYVDFNYSGNLLASVGSNPDYTLTIWNWKEEQPILRTKAFSQEVFKVTF    211 - 280
NPDKEEQLTTSGSGHIKFWEMAFTFTGLKLQGSLGRFGKTITTDIEGYMELPDGKVLSGSEWGNMLLWEG    281 - 350
GLIKVELCRGTSKSCHNGPINQIMLYEGEVITVGSDGYVRIWDFETIDTADVIDETGLLEIEPINELQVD    351 - 420
KNVNLFSMIKMNETGNNFWLAQDANGAIWKLDLSFSNITQDPECLFSFHSGAIEAVAVSPLTYLMATTAL    421 - 490
DCSVRIYDFASKTPLAQMKFKQGGTALVWVPRMVNFTGAQIIVGFEDGVVRILELYDPKGLTIFAGRKKI    491 - 560
LDADIQLKQVFKPHTACVTALAYERDGEILATGSKDQTVFFFEVERDYKPIGYINTPGPVCQLMWSPMSH    561 - 630
PESTLLIICENGYILEAPLPTIKQEEDDHDVVSYEIKDMCIKCFHFSSVKSKILRLIEIEKRERQRELKE    631 - 700
KIREERRNKLAAEMGEDGEKEFQEEEEEKEEEEEEEEPLPEIFIPSTPSPILCGFYSEPGKFWVSLGGYD    701 - 770
SGFLYHCEFPPCDESSDFKEQKDEPIDVRYLADTEDNPIQTITFNINKVMMFCGMKNGAIRVYVLNQNDP    771 - 840
SLTSLVDYWHFNMHDNNYGCIKSIANSFDDRFLVTAGADGNIFVFNIFSEFMLRKDMKAKVPSPRFGIET    841 - 910
EPIPEDIEDPKAYSIENARRKREHDKLMKEVGEIKARKREQIKALRSEFCNLLEMNEKLPKHMQFKRTVS    911 - 980
LI                                                                        981 - 982
//

Text Mined References (9)

PMID Year Title