Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96MT4 Q3SY08 Q3SY09 Q3SY10 Q5TAW4
Symbols C6orf195
bA145H9.2

 Compartment GO Term (1)

Protein-protein Interaction (1)

AA Sequence

MIYPLDLFRNIPWKQGKCFASLSPEGERAFDGMEPLCQPGARPALRGLQHASDCYRLLSPPGSGLVGTNP      1 - 70
SVPAPSPHCGCCQAWSISSFTFTGPTPFKINSDQATPCHLRSPETIFRQREISNEAF                  71 - 127
//

Text Mined References (5)

PMID Year Title