Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Lung squamous cell carcinoma 10 3.822 1.9

Synonym

Accession Q96MT4 Q3SY08 Q3SY09 Q3SY10 Q5TAW4
Symbols C6orf195
bA145H9.2

Gene

 Compartment GO Term (1)

AA Sequence

MIYPLDLFRNIPWKQGKCFASLSPEGERAFDGMEPLCQPGARPALRGLQHASDCYRLLSPPGSGLVGTNP      1 - 70
SVPAPSPHCGCCQAWSISSFTFTGPTPFKINSDQATPCHLRSPETIFRQREISNEAF                  71 - 127
//

Text Mined References (5)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.