Property Summary

NCBI Gene PubMed Count 32
PubMed Score 19.99
PubTator Score 14.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.600 1.4e-03
astrocytic glioma -2.300 3.0e-03
Astrocytoma, Pilocytic -1.300 2.0e-03
atypical teratoid / rhabdoid tumor -2.300 6.5e-05
Breast cancer 1.500 4.7e-04
ependymoma -1.600 1.4e-05
glioblastoma -1.200 6.3e-04
group 3 medulloblastoma -1.800 2.2e-03
intraductal papillary-mucinous carcinoma... -1.100 4.8e-02
lung adenocarcinoma -1.100 1.7e-09
medulloblastoma, large-cell -2.800 1.9e-04
oligodendroglioma -1.800 2.8e-02
osteosarcoma -1.739 2.4e-02
ovarian cancer -1.100 6.9e-03
pituitary cancer 1.300 6.8e-04
primary pancreatic ductal adenocarcinoma 1.096 5.3e-03
primitive neuroectodermal tumor -2.000 2.3e-03

 GO Function (1)

Gene RIF (17)

AA Sequence

MPLEMEPKMSKLAFGCQRSSTSDDDSGCALEEYAWVPPGLRPEQIQLYFACLPEEKVPYVNSPGEKHRIK      1 - 70
QLLYQLPPHDNEVRYCQSLSEEEKKELQVFSAQRKKEALGRGTIKLLSRAVMHAVCEQCGLKINGGEVAV     71 - 140
FASRAGPGVCWHPSCFVCFTCNELLVDLIYFYQDGKIHCGRHHAELLKPRCSACDEIIFADECTEAEGRH    141 - 210
WHMKHFCCLECETVLGGQRYIMKDGRPFCCGCFESLYAEYCETCGEHIGVDHAQMTYDGQHWHATEACFS    211 - 280
CAQCKASLLGCPFLPKQGQIYCSKTCSLGEDVHASDSSDSAFQSARSRDSRRSVRMGKSSRSADQCRQSL    281 - 350
LLSPALNYKFPGLSGNADDTLSRKLDDLSLSRQGTSFASEEFWKGRVEQETPEDPEEWADHEDYMTQLLL    351 - 420
KFGDKSLFQPQPNEMDIRASEHWISDNMVKSKTELKQNNQSLASKKYQSDMYWAQSQDGLGDSAYGSHPG    421 - 490
PASSRRLQELELDHGASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSLALSNITGASVDGENKPRPSL    491 - 560
YSLQNFEEMETEDCEKMSNMGTLNSSMLHRSAESLKSLSSELCPEKILPEEKPVHLPVLRRSKSQSRPQQ    561 - 630
VKFSDDVIDNGNYDIEIRQPPMSERTRRRVYNFEERGSRSHHHRRRRSRKSRSDNALNLVTERKYSPKDR    631 - 700
LRLYTPDNYEKFIQNKSAREIQAYIQNADLYGQYAHATSDYGLQNPGMNRFLGLYGEDDDSWCSSSSSSS    701 - 770
DSEEEGYFLGQPIPQPRPQRFAYYTDDLSSPPSALPTPQFGQRTTKSKKKKGHKGKNCIIS             771 - 831
//

Text Mined References (32)

PMID Year Title