Knowledge Summary

Patent

No data available

Synonym

Accession Q96MT0
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MFLHSGPARGPCTAAGRSASVRVPVQVAHELQGPDAIVFGAEVEQVHLVANELDAGRVQLLLAQGVAAAV      1 - 70
LLVQVVMGEELGEQGHQQARGEVADGQAALLDTAKMLVAEQAVGAGQLQVGLGISNLSKSIGTSQIFLER     71 - 140
HRSPLKLSSTLITEMSSGRLEEL                                                   141 - 163
//

Text Mined References (1)

PMID Year Title