Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.409 0.000
pilocytic astrocytoma -1.200 0.000
pituitary cancer 1.300 0.001

Synonym

Accession Q96MR7 Q5T438 Q8N372
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MYTASSSAETLRTVRRRSVPSSSMPYLALAHNRVSSLNHAASVDGWGTSHRNVADSFSRTSRSCSRFLKG      1 - 70
TAGSARREDWNGHLQPWIPRPDRRGWETADRKGERTQVHGLRRSLGPRAPHPGAHRALRPAQSCRSGPRG     71 - 140
WTPCRCRGRGPTACRRGS                                                        141 - 158
//

Text Mined References (5)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.