Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Astrocytoma, Pilocytic 3006 2.6e-06
osteosarcoma 7766 1.5e-05
pituitary cancer 1915 5.5e-04

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic -1.200 2.6e-06
osteosarcoma -1.409 1.5e-05
pituitary cancer 1.300 5.5e-04

AA Sequence

MYTASSSAETLRTVRRRSVPSSSMPYLALAHNRVSSLNHAASVDGWGTSHRNVADSFSRTSRSCSRFLKG      1 - 70
TAGSARREDWNGHLQPWIPRPDRRGWETADRKGERTQVHGLRRSLGPRAPHPGAHRALRPAQSCRSGPRG     71 - 140
WTPCRCRGRGPTACRRGS                                                        141 - 158
//

Text Mined References (5)

PMID Year Title