Property Summary

NCBI Gene PubMed Count 18
PubMed Score 35.21
PubTator Score 10.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma 1.100 5.2e-05
medulloblastoma, large-cell -1.100 1.1e-04
mucosa-associated lymphoid tissue lympho... 1.040 3.2e-02
osteosarcoma -2.492 3.2e-08
psoriasis -1.700 1.7e-04

Gene RIF (7)

AA Sequence

MVVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPEVVPLNIGGAHFTTRLSTLR      1 - 70
CYEDTMLAAMFSGRHYIPTDSEGRYFIDRDGTHFGDVLNFLRSGDLPPRERVRAVYKEAQYYAIGPLLEQ     71 - 140
LENMQPLKGEKVRQAFLGLMPYYKDHLERIVEIARLRAVQRKARFAKLKVCVFKEEMPITPYECPLLNSL    141 - 210
RFERSESDGQLFEHHCEVDVSFGPWEAVADVYDLLHCLVTDLSAQGLTVDHQCIGVCDKHLVNHYYCKRP    211 - 280
IYEFKITWW                                                                 281 - 289
//

Text Mined References (19)

PMID Year Title