Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
tuberculosis and treatment for 6 months 409 4.6e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
tuberculosis and treatment for 6 months -1.100 4.6e-06

Synonym

Accession Q96MP5 Q9BR13
Symbols PPP1R174
C20orf164

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MELGSCFKTYEDFKECFSAYKRENRCSFILRDCVSVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRT      1 - 70
READMCPAYLLLRYNERLDRLFISELNTQHIHGDSKVASPGGDTTGKSQKTMCLQRLQPVQPTTKKDLDT     71 - 140
AEKSLVEPSFCLDKVQVSSKPEQEGITPSDLAKIAKVMKNFLKVDEGSMASFSVGDSQHLDRLSFQSSKM    141 - 210
TDLFIRFPENLLLHRVENTQGHILYAFLVENKERESRVVHFAVLKAETVTSVAKMLSIFTEFNSDWPKVK    211 - 280
VVFVDPSFHYRAILQEIFPAARILLSIYHTTRLLEKKLHRSSANPSFKRLMKEALREAVFVTSEASLKNL    281 - 350
CQMSQAVLDEDLFNFLQAHWFTCELLWYMHVRKGLLACNTYMDSLDIVTSKVSSLFREQQSLLDCILCFV    351 - 420
DYIDFFNTKGLKNLPTPPPKLKRARPASMPLKSKKAFGICGESLTSLPAEETKPDAQQVQVQQQSQVPPS    421 - 490
QVGMLDTLHQSGSELAYKLCHNEWEVVQNSTHLVDMAGSSVDVQLLEDSHQVSKDGCSCSCSFQQWYHLP    491 - 560
CRHILALLHTSQQPVGEAMVCRRWQKKYQYLLGPNGELQDRGMVPNTGQPEKQGRNDMIQDLSRELANLL    561 - 630
MQTEGPELEERYSTLRKIVDIWAGPSQPSELFQQPGDFKDVGRLPFLWGKQEEGEGFPPATAVMHY        631 - 696
//

Text Mined References (6)

PMID Year Title