Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.02
PubTator Score 1.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8519 1.3e-07
osteosarcoma 7950 7.4e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.218 7.4e-04
ovarian cancer 1.100 1.3e-07

Synonym

Accession Q96MN5 Q5T702 Q8N8N2
Symbols C1orf83

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MDKFVIRTPRIQNSPQKKDSGGKVYKQATIESLKRVVVVEDIKRWKTMLELPDQTKENLVEALQELKKKI      1 - 70
PSREVLKSTRIGHTVNKMRKHSDSEVASLAREVYTEWKTFTEKHSNRPSIEVRSDPKTESLRKNAQKLLS     71 - 140
EALELKMDHLLVENIERETFHLCSRLINGPYRRTVRALVFTLKHRAEIRAQVKSGSLPVGTFVQTHKK      141 - 208
//

Text Mined References (8)

PMID Year Title