Property Summary

NCBI Gene PubMed Count 17
Grant Count 4
Funding $165,593.67
PubMed Score 50.73
PubTator Score 30.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Carcinoma 2,147 1.0

Synonym

Accession Q96MN2 Q86W87 Q96AY6
Symbols CT58
PAN2
RNH2
NALP4
PYPAF4
CLR19.5

Gene

PDB

4EWI  

Gene RIF (7)

PMID Text
25403012 This study describes conformational stability of native NLRP14 and mutants in their monomeric and dimeric states and compares them to NLRP4, a representative of a native pyrin domain fold.
24871464 Findings suggest that NLR family pyrin domain containing 2 (NLRP2P) is a processed pseudogene that regulates NF-kappaB RelA/p65 activity and thus represents the newest member of the POP family, pyrin-only protein 4 (POP4; NLRP4).
22928810 Structural and functional analysis of the NLRP4 pyrin domain.
22388039 Our results provide molecular insight into the mechanisms by which NLRP4-DTX4 targets TBK1 for degradation.
21209283 NLRP4 is recruited to and accumulates in bacteria-containing phagosomes and transiently dissociates from beclin1 following group A streptococcus infection, thereby controlling the autophagic flux crucial for cell-autonomous antibacterial resistance.
20403135 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAASFFSDFGLMWYLEELKKEEFRKFKEHLKQMTLQLELKQIPWTEVKKASREELANLLIKHYEEQQAWN      1 - 70
ITLRIFQKMDRKDLCMKVMRERTGYTKTYQAHAKQKFSRLWSSKSVTEIHLYFEEEVKQEECDHLDRLFA     71 - 140
PKEAGKQPRTVIIQGPQGIGKTTLLMKLMMAWSDNKIFRDRFLYTFYFCCRELRELPPTSLADLISREWP    141 - 210
DPAAPITEIVSQPERLLFVIDSFEELQGGLNEPDSDLCGDLMEKRPVQVLLSSLLRKKMLPEASLLIAIK    211 - 280
PVCPKELRDQVTISEIYQPRGFNESDRLVYFCCFFKDPKRAMEAFNLVRESEQLFSICQIPLLCWILCTS    281 - 350
LKQEMQKGKDLALTCQSTTSVYSSFVFNLFTPEGAEGPTPQTQHQLKALCSLAAEGMWTDTFEFCEDDLR    351 - 420
RNGVVDADIPALLGTKILLKYGERESSYVFLHVCIQEFCAALFYLLKSHLDHPHPAVRCVQELLVANFEK    421 - 490
ARRAHWIFLGCFLTGLLNKKEQEKLDAFFGFQLSQEIKQQIHQCLKSLGERGNPQGQVDSLAIFYCLFEM    491 - 560
QDPAFVKQAVNLLQEANFHIIDNVDLVVSAYCLKYCSSLRKLCFSVQNVFKKEDEHSSTSDYSLICWHHI    561 - 630
CSVLTTSGHLRELQVQDSTLSESTFVTWCNQLRHPSCRLQKLGINNVSFSGQSVLLFEVLFYQPDLKYLS    631 - 700
FTLTKLSRDDIRSLCDALNYPAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLL    701 - 770
CEALCSPDTVLVYLMLAFCHLSEQCCEYISEMLLRNKSVRYLDLSANVLKDEGLKTLCEALKHPDCCLDS    771 - 840
LCLVKCFITAAGCEDLASALISNQNLKILQIGCNEIGDVGVQLLCRALTHTDCRLEILGLEECGLTSTCC    841 - 910
KDLASVLTCSKTLQQLNLTLNTLDHTGVVVLCEALRHPECALQVLGLRKTDFDEETQALLTAEEERNPNL    911 - 980
TITDDCDTITRVEI                                                            981 - 994
//

Text Mined References (17)

PMID Year Title
25403012 2015 Intrinsic flexibility of NLRP pyrin domains is a key factor in their conformational dynamics, fold stability, and dimerization.
24871464 2014 The CLRX.1/NOD24 (NLRP2P) pseudogene codes a functional negative regulator of NF-?B, pyrin-only protein 4.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22928810 2012 Structural and functional analysis of the NLRP4 pyrin domain.
22388039 2012 NLRP4 negatively regulates type I interferon signaling by targeting the kinase TBK1 for degradation via the ubiquitin ligase DTX4.
21209283 2011 NLRP4 negatively regulates autophagic processes through an association with beclin1.
20403135 2010 The genetics of NOD-like receptors in Crohn's disease.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15107016 2004 Heterotypic interactions among NACHT domains: implications for regulation of innate immune responses.
More...