Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.14
PubTator Score 7.56

Knowledge Summary

Patent

No data available

Expression

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
24563483 HS6ST-1 and HS6ST-2 have roles in regulating the angiogenic program in ovarian cancer cells affecting HB-EGF signaling and subsequent expression of angiogenic cytokines by cancer cells
21443520 HS6ST2 knockdown disrupts epithelial-mesenchymal transition and suggesets that HS6ST2 potentiates Notch signaling in pancreatic cancer cells.
12492399 we have characterized HS6ST-2 and HS6ST-1 human isologues, including their chromosomal localizations,HS6STs could also transfer sulfate to N -sulfoglucosamine residues located at the non-reducing terminal of HS with high affinity.

AA Sequence

MALPACAVREFEPPRQPERGAPVRTTCPRRHSRVEAELAASRPGSVAASVRAGPPRGVSHGFHTRPLLDK      1 - 70
PRKASSSLAGAACAPLFALLSRGRRRRMHVLRRRWDLGSLCRALLTRGLAALGHSLKHVLGAIFSKIFGP     71 - 140
MASVGNMDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQLLRLQAFSSPVPDPYRSEDESSARFVPRYNF    141 - 210
TRGDLLRKVDFDIKGDDLIVFLHIQKTGGTTFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKRETWLFSR    211 - 280
FSTGWSCGLHADWTELTSCVPSVVDGKRDARLRPSRNFHYITILRDPVSRYLSEWRHVQRGATWKASLHV    281 - 350
CDGRPPTSEELPSCYTGDDWSGCPLKEFMDCPYNLANNRQVRMLSDLTLVGCYNLSVMPEKQRNKVLLES    351 - 420
AKSNLKHMAFFGLTEFQRKTQYLFEKTFNMNFISPFTQYNTTRASSVEINEEIQKRIEGLNFLDMELYSY    421 - 490
AKDLFLQRYQFMRQKEHQEARRKRQEQRKFLKGRLLQTHFQSQGQGQSQNPNQNQSQNPNPNANQNLTQN    491 - 560
LMQNLTQSLSQKENRESPKQNSGKEQNDNTSNGTNDYIGSVEKWR                             561 - 605
//

Text Mined References (12)

PMID Year Title
24563483 2014 Ovarian cancer cell heparan sulfate 6-O-sulfotransferases regulate an angiogenic program induced by heparin-binding epidermal growth factor (EGF)-like growth factor/EGF receptor signaling.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21443520 2011 Silencing of hHS6ST2 inhibits progression of pancreatic cancer through inhibition of Notch signalling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12492399 2003 Biosynthesis of heparan sulphate with diverse structures and functions: two alternatively spliced forms of human heparan sulphate 6-O-sulphotransferase-2 having different expression patterns and properties.
More...