Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.52
PubTator Score 4.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.319 0.025
non-small cell lung cancer -2.048 0.000
breast carcinoma -1.700 0.000
fibroadenoma -1.500 0.004
lung adenocarcinoma -3.100 0.000
ductal carcinoma in situ -1.200 0.005
invasive ductal carcinoma -1.800 0.000

Gene RIF (14)

PMID Text
27083952 HSPA12B plays a protective role in vascular endothelial barrier dysfunction by preserving the endothelial permeability during sepsis.
26428665 The HSPA12B might regulate the expression and activity of SSeCKS to promote astrocyte inflammatory activation and release of inflammatory mediators, such as TNF-alpha and IL-1beta in spinal cord primary astroglial cultures exposed to LPS treatment.
25909170 Results indicate that HSPA12B stimulates lung tumor growth via a Cox-2-dependent mechanism. The present study identified HSPA12B as a novel facilitator of lung tumor growth.
25545050 HSPA12B attenuates lipopolysaccharide-induced inflammatory responses in human umbilical vein endothelial cells via activation of PI3K/Akt signalling pathway.
24977412 Plasma extracellular HSPA12B is elevated in both septic mice and patients.
23729663 inhibition of eNOS abrogated the protection of HSPA12B against cardiac dysfunction and remodelling after myocardial infarction
23046810 Overexpression of HSPA12B protects against cerebral ischemia/reperfusion injury via a PI3K/Akt-dependent mechanism.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLAVPEMGLQGLYIGSSPERSPVPSPPGSPRTQESCGIAPLTPSQSPKPEVRAPQQASFSVVVAIDFGTT      1 - 70
SSGYAFSFASDPEAIHMMRKWEGGDPGVAHQKTPTCLLLTPEGAFHSFGYTARDYYHDLDPEEARDWLYF     71 - 140
EKFKMKIHSATDLTLKTQLEAVNGKTMPALEVFAHALRFFREHALQELREQSPSLPEKDTVRWVLTVPAI    141 - 210
WKQPAKQFMREAAYLAGLVSRENAEQLLIALEPEAASVYCRKLRLHQLLDLSGRAPGGGRLGERRSIDSS    211 - 280
FRQAREQLRRSRHSRTFLVESGVGELWAEMQAGDRYVVADCGGGTVDLTVHQLEQPHGTLKELYKASGGP    281 - 350
YGAVGVDLAFEQLLCRIFGEDFIATFKRQRPAAWVDLTIAFEARKRTAGPHRAGALNISLPFSFIDFYRK    351 - 420
QRGHNVETALRRSSVNFVKWSSQGMLRMSCEAMNELFQPTVSGIIQHIEALLARPEVQGVKLLFLVGGFA    421 - 490
ESAVLQHAVQAALGARGLRVVVPHDVGLTILKGAVLFGQAPGVVRVRRSPLTYGVGVLNRFVPGRHPPEK    491 - 560
LLVRDGRRWCTDVFERFVAAEQSVALGEEVRRSYCPARPGQRRVLINLYCCAAEDARFITDPGVRKCGAL    561 - 630
SLELEPADCGQDTAGAPPGRREIRAAMQFGDTEIKVTAVDVSTNRSVRASIDFLSN                  631 - 686
//

Text Mined References (20)

PMID Year Title
27083952 2016 Heat shock protein A12B protects against sepsis-induced impairment in vascular endothelial permeability.
26428665 2015 HSPA12B regulates SSeCKS-mediated astrocyte inflammatory activation in neuroinflammation.
25909170 2015 HSPA12B: a novel facilitator of lung tumor growth.
25545050 2015 HSPA12B inhibits lipopolysaccharide-induced inflammatory response in human umbilical vein endothelial cells.
25416956 2014 A proteome-scale map of the human interactome network.
24977412 2014 Plasma HSPA12B is a potential predictor for poor outcome in severe sepsis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23729663 2013 HSPA12B attenuates cardiac dysfunction and remodelling after myocardial infarction through an eNOS-dependent mechanism.
23046810 2013 Overexpression of HSPA12B protects against cerebral ischemia/reperfusion injury via a PI3K/Akt-dependent mechanism.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
More...