Property Summary

NCBI Gene PubMed Count 16
PubMed Score 18.78
PubTator Score 15.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

Gene RIF (8)

AA Sequence

MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALCDGYVCYEPGPQALGGDDFSD      1 - 70
CYIECVIRGEFSQPILEEDSLFESLEYLKKGSEQQLSQKVFEASSLECSLEYMKKGVKKELPQKIVGENS     71 - 140
LEYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARKKPPINKEYDSLSAIACPQSGCTRKLRNRAALRKHLL    141 - 210
IHGPRDHVCAECGKAFVESSKLKRHFLVHTGEKPFRCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQ    211 - 280
GCNRRFIQSNNLKAHILTHANTNKNEQEGK                                            281 - 310
//

Text Mined References (18)

PMID Year Title