Property Summary

NCBI Gene PubMed Count 15
Grant Count 11
R01 Count 9
Funding $785,365.5
PubMed Score 18.35
PubTator Score 15.01

Knowledge Summary

Patent

No data available

Gene RIF (7)

PMID Text
23939908 Results show that a novel pluripotency regulator, REX1, is essential for pluripotency and reprogramming.
21446939 reduced expression protein-1 (REX-1) is widely expressed in human skin and may be involved in cutaneous differentiation but not in stem cell fate determination.
20232320 hRex1 binds to the hRex1 promoter region at -298 bp and positively regulates hRex1 transcription, but this regulation is lost in PC-3 human prostate cancer cells.
18281244 expression of REX-1 in meiotic cells from both testes and ovary indicate a role in meiosis.
17211834 Data show that Oct-4, Rex-1, and Gata-4 expression in human mesenchymal stem cells increases cell differentiation efficiency but not hTERT expression.
16865673 REX1 functions in normal adult epithelial cells and tumorigenic stem cells.
15790780 MAPCs express the OCT4 and REX1 transcription factors, two specific markers of undifferentiated embryonic stem (ES) cells.

AA Sequence

MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALCDGYVCYEPGPQALGGDDFSD      1 - 70
CYIECVIRGEFSQPILEEDSLFESLEYLKKGSEQQLSQKVFEASSLECSLEYMKKGVKKELPQKIVGENS     71 - 140
LEYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARKKPPINKEYDSLSAIACPQSGCTRKLRNRAALRKHLL    141 - 210
IHGPRDHVCAECGKAFVESSKLKRHFLVHTGEKPFRCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQ    211 - 280
GCNRRFIQSNNLKAHILTHANTNKNEQEGK                                            281 - 310
//

Text Mined References (17)

PMID Year Title
25244616 2015 Cobalt chloride supplementation induces stem-cell marker expression and inhibits osteoblastic differentiation in human periodontal ligament cells.
25209548 2014 A prominent and conserved role for YY1 in Xist transcriptional activation.
25157408 2014 Role of tumor suppressor genes in the cancer-associated reprogramming of human induced pluripotent stem cells.
23939908 2013 Unveiling the critical role of REX1 in the regulation of human stem cell pluripotency.
21446939 2011 Embryonic stem cell factors undifferentiated transcription factor-1 (UFT-1) and reduced expression protein-1 (REX-1) are widely expressed in human skin and may be involved in cutaneous differentiation but not in stem cell fate determination.
20232320 2010 Transcriptional regulation of Rex1 (zfp42) in normal prostate epithelial cells and prostate cancer cells.
18281244 2008 Presumed pluripotency markers UTF-1 and REX-1 are expressed in human adult testes and germ cell neoplasms.
17211834 2007 Oct-4, Rex-1, and Gata-4 expression in human MSC increase the differentiation efficiency but not hTERT expression.
16865673 2006 The putative human stem cell marker, Rex-1 (Zfp42): structural classification and expression in normal human epithelial and carcinoma cell cultures.
16424014 2006 Down-regulation of stem cell genes, including those in a 200-kb gene cluster at 12p13.31, is associated with in vivo differentiation of human male germ cell tumors.
More...