Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -4.443 0.000
glioblastoma 1.500 0.002
adrenocortical adenoma -1.451 0.025
adrenocortical carcinoma -2.928 0.000
interstitial cystitis 2.400 0.000
pediatric high grade glioma 1.500 0.000
pilocytic astrocytoma 1.800 0.000
psoriasis 1.600 0.000
Breast cancer 1.400 0.000
invasive ductal carcinoma -1.100 0.008
ulcerative colitis 1.700 0.000
ovarian cancer -1.500 0.000

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSVRLRFLSPGDTGAVGVVGRSASFAGFSSAQSRRIAKSINRNSVRSRMPAKSSKMYGTLRKGSVCADPK      1 - 70
PQQVKKIFEALKRGLKEYLCVQQAELDHLSGRHKDTRRNSRLAFYYDLDKQTRCVERHIRKMEFHISKVD     71 - 140
ELYEDYCIQCRLRDGASSMQRAFARCPPSRAARESLQELGRSLHECAEDMWLIEGALEVHLGEFHIRMKG    141 - 210
LVGYARLCPGDHYEVLMRLGRQRWKLKGRIESDDSQTWDEEEKAFIPTLHENLDIKVTELRGLGSLAVGA    211 - 280
VTCDIADFFTTRPQVIVVDITELGTIKLQLEVQWNPFDTESFLVSPSPTGKFSMGSRKGSLYNWTPPSTP    281 - 350
SFRERYYLSVLQQPTQQALLLGGPRATSILSYLSDSDLRGPSLRSQSQELPEMDSFSSEDPRDTETSTSA    351 - 420
STSDVGFLPLTFGPHASIEEEAREDPLPPGLLPEMAHLSGGPFAEQPGWRNLGGESPSLPQGSLFHSGTA    421 - 490
SSSQNGHEEGATGDREDGPGVALEGPLQEVLELLRPTDSTQPQLRELEYQVLGFRDRLKPCRARQEHTSA    491 - 560
ESLMECILESFAFLNADFALDELSLFGGSQGLRKDRPLPPPSSLKASSRELTAGAPELDVLLMVHLQVCK    561 - 630
ALLQKLASPNLSRLVQECLLEEVAQQKHVLETLSVLDFEKVGKATSIEEIIPQASRTKGCLKLWRGCTGP    631 - 700
GRVLSCPATTLLNQLKKTFQHRVRGKYPGQLEIACRRLLEQVVSCGGLLPGAGLPEEQIITWFQFHSYLQ    701 - 770
RQSVSDLEKHFTQLTKEVTLIEELHCAGQAKVVRKLQGKRLGQLQPLPQTLRAWALLQLDGTPRVCRAAS    771 - 840
ARLAGAVRNRSFREKALLFYTNALAENDARLQQAACLALKHLKGIESIDQTASLCQSDLEAVRAAARETT    841 - 910
LSFGEKGRLAFEKMDKLCSEQREVFCQEADVEITIF                                      911 - 946
//

Text Mined References (7)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15197164 2004 A transcript finishing initiative for closing gaps in the human transcriptome.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.